type: prom upgrade arch: elan md5: 8ba03130339ccf5369d23ffbeeb97dcf image_size: 470892 prom_version: prom-E3.3.0.0 @`<z$`)$z$`%@@p$[%@`<7{[$@`-<@$@#Z$Nz$@#Z$Mz$@#Z$Iz` S-       @v\`؀ \%l:Ԁ"JJJT-<eh<@%<  @$ &+>@x@`@@<A$$ <@A%<A%@`@h<g<h%<456<45^k<e]<  @$ &+<e]< e)< eJѴ +%%)*+ <dBѴ<dc<@@@@ $BC+ <e]<  @$ &+<gZ"<d<d$$$<d<d$<e@@-@$p@%h@'@0-<g<%----- - (-@0--<gZIP@ <gZ"@<@%<H%<0%%$ + xX<dB<A%@@`hp@<A $2<@A $.0D0E+ %< !<A($@<A($@0@@<d:$@ph`XxB@$@0-@8-@ $!H$5)@'诿< e)P$ $ @ @!%JK<d<d$$$<d<d$k'@< HH$ 5@< HH$ 5@<4< $<4<4<4P<$<4x<#4B$<4<4B@$<4<#4B$<4<4B $<4<#4B$<4 <4B$<4 <#4B$<4(<4B$<4(<#4B$<40$$<48$$<4@$$<4p<4B$<4x<4B$<4$$<4 $$<4܂<4<<<4܂<4<$4B<<4<$<4`<4B$<4h< 4B$<4<F$<4<54B<4BP<4<4B$<4$<4<F<4<4B$<4<4B$<45-@`@ <!@%@`$!H$5)3@@@@(<$/@P@$ B$<$C;$$B@<5 1HB R1I @%B R1I @%B R1I @% R$  @$ << %  << %  << %  @`<@$<@`--(-$ % -@-$ < ek,<aX%`$<@I 1)  D<@4 I 4 I 4 xI4 I 4 I 4 I 4 I 4 I4 I4 xI4 I4 I4 I4 I$< H5$$H$HED< 5)H1 !) $H1  1  $H%$d ! B$$d ! 8-<<4< 5JH< 5) @$<  @%H-$$`V@- H $ H$ H$$`B@-$`=B $`8 H5$ `1@-$ `,@-@H@P@B" "$ "$ "$ ""  $ ""$ $  - -$!@"@"-$$`X@- H $ H$ H$F$`B@-$`=B $`8 H5$ `1@-$ `,%@H@P@B" "$ "$ "$ ""  $ ""$ $ $!@"@"- ---$ @"--@" $@"<@<@$ @" 3@" 3 @"3$$<4@%<p$~<p$rx%4p$rx%4p$v@%$ ! $ @",$ 7H%2H%<!p$~<!p$rx%4!p$rx%4!p$vH%<$d ! <4@H-<!p$~<!p$rx%4!p$rx%4!p$vH%$ @"5& & <$ 5H%3H%<!p$~<!p$rx%4!p$rx%4!p$vH%<4$d ! <4 `H-<!p$~<!p$rx%4!p$rx%4!p$vH%< 5JH< 5) @$<  @%H-@x1B$ ' @--1  JB$ *P$ 1  $ 1  I$ +X$ 1  $`-x-<H$ <H$ M$/x<0H$ <  `--@-<*<<+<<,<<8<<-<<.<</<<9<@x1B<(<@x1B$ ' -@-@`<@b$<a%@`@<(! !<(! !<(! !<(! ! <(!0!$<*<<+<<,<<8<<-<<.<</<<9<@`@x1B<(<< )<$ '*-<<<<< H!$@P'@$%)*H$ @!<<<< H!$@P'@$%)*H$ @!<<<< 1@ H!$@P'@$%)*H$ @!< )<$ '*9<<<<< H!$@P'@$%)*H$ @!< )<$ '*<< H!$@P'@$%)*H$ @!<< @ H!$@P'@$%)*H$  @!< )<$ '*3<< @ H!$@P'@$%)*H$  @!<< H!$@P'@$%)*H$ @!-m@-@`<@b$<a%@`@@<<4@$ <<4@$ @<<4@$ @<<$ <<$ @<(!$ @<<4@$ <*<<+<<,<<8<<-<<.<</<<9<@`@x1B<(<$ @$ @< @<0@$E<$ $ $ $ @$  @%$  @%<H$ `-x-$  H' @$<H$ --$  H' @$@<<<<< H!$@P'@$%)*H$ @!<<<< H!$@P'@$%)*H$ @!<<<<@ H!$@P'@$%)*H$ @!<<<< 1@ H!$@P'@$%)*H$ @!<<<<< H!$@P'@$%)*H$ @!<<<<@ H!$@P'@$%)*H$ @!<<<< 1@ H!$@P'@$%)*H$ @!<< @ H!$@P'@$%)*H$  @!<< @ H!$@P'@$%)*H$  @!<< H!$@P'@$%)*H$ @!$  H!$@P'@$%)*H$ @!<< @ H!$@P'@$%)*H$ @!<<$H !)(H$ $$(#$@ H!$@P'@$%)*H$ @!$$$$$$p$h$P$H$0$($$###ȿ########`#X#8###0# ##"""ؿ"ȿ""""""decimal number0tnumoctal number0onumhex number0xnumvalue of symbol&namecontents of register@namecontents of address^addroperators+-*/()recall and execute cmd num!numrecall and execute cmd str!strrepeat last cmd!!delete line from cursor^Kdelete char before cursor^Hdelete char at cursor^Dmove cursor far right^Emove cursor far left^Amove cursor left^Bmove cursor right^Frecall next cmd^Nrecall previous cmd^P break! prompt%d%s Boot Software Version %s, Built %s Processor: %s%d LRRProcessor: (unknown) rev %ld.%ld [0x%04x], %d MHz, (bus: %d MHz), DRAM: hardcoded to 0x%x ::%2d KB %2d MB ECC DRAM itfailure'v' pressed: /int-flash mount bypassed Error: The boot flash filesystem could not be mounted. init'v' pressed: /pc-flash mount bypassed /int-flash/cfg/startupautobootNOTE: power-on tests reported: %s autoboot skipped network disabled nobootdelay'bootdelay' variable invalid, defaulting to 20 seconds Autoboot in %d seconds - press ESC to abort and enter prom (RTC appears invalid, faking delay with %ld loops instead) CHECK AND RESET THE DATE Line too long after expansion Variable syntax Undefined variable %s rptcmdttobad rptcmd value [%s] usage: %s %s %s: Command not found. Type 'h' for help. USER COMMANDS: DIAGNOSTIC COMMANDS:*%s: command not found %-*s %-*s%-*s %-*s %-*s %-*s%*s %-*s %s%*s %15s %sThe %s command cannot be invoked by name. I-Cache %d KB, linesize %d. D-Cache %d KB, linesize %d. L2-Cache %d KB, linesize %d, L2-Cache %d MB, linesize %d, cache %s. enableddisabledL3-Cache %d KB, linesize %d, L3-Cache %d MB, linesize %d, searching.. %s: neither hex value nor symbol +**ؿ*set the MAC address (format: aabbcc:ddeeff)-mset the board id (MLS1000 = 1)-iBoard ID = %ld MAC Address = %02x%02x%02x:%02x%02x%02x %ldfailed to write board id sts = %d sysid%02x%02x%02x:%02x%02x%02xfailed to write MAC bytes 0 and 1 failed to write MAC bytes 2 and 3 failed to write MAC bytes 4 and 5 %02x:%02x:%02x:%02x:%02x:%02xethaddrRebooting. . . traborttr: error: trabort not set hostporttty0can't use tty0 as hostport in transparent mode can't open %s Entering transparent mode, %s to abort ---x-`-X-P-H-8-0-(quit.back one^|-re-read=forward one, no changeCRset memory, forward onehexval-sbad arg count %08lx %02x ..h.`.@.8. .-do it in 64 bit mode to cached region-cdo it in 64 bit mode-p32 bit hexadecimal valuevaladdress to modifyadr..address to display%08lx: %08lx %08lx: swapped: %08lx 'to' address too small %s%c: unknown option Function address not specified Function returns: 0x%x (%d) +//x/hflush D-cache-dflush I-cache%c: bad option %s: bad argument 00//send dump to host -hdump binary image-BBh:can't dump binary to tty uleofulcrcr lf S3%02lX%08lX%02X%02X%sS70500000000FA%s11p1h1P1H10-110display as register-rdisplay a null terminated stringdisplay as words-wdisplay as half-words-hdisplay as bytes-bdatasz%s: bad datasz value %s: unknown argument address not specified %s %s: bad register name B܀CBĀCCCBԀCCCCCCCCCBBCCCB%08lx %02x %04x %08lx %016llx +-*/divide by zero %s: bad indirect address epc%s: bad symbol name inbase%s: bad inbase value %s: bad base %s value inalpha%s: bad inalpha value id23bad option '%s' rVpI-Cache: (4-way, index=0..127, 32b per line) %3d: !b0x%08x, , D-Cache: (4-way, index=0..127, 32b per line) DcL2-Cache: (4-way, index=0..2047, 32b per line) 5555ؿ5п5ȿ5555555555x5p5h5`5X5P5H5@58505(5 55554ras8spgpk1k0t9t8s7s6s5s4s3s2s1s0t7t6t5t4t3t2t1t0a3a2a1a0v1v0atzero7p7h7`7X7P7H7@78707(7 777766666ؿ6п6ȿ6666666666x$31$30$29$28$27$26$25$24$23$22$21$20$19$18$17$16$15$14$13$12$11$10$9$8$7$6$5$4$3$2$1$09@989(9988788ؿ8ȿ8888888p8`8P8@6п6ȿ6666888(8876xC0_ERRPCC0_TAGHIC0_TAGLOC0_CACHERRC0_ECCC0_WATCHHIC0_WATCHLOC0_LLADDRC0_CONFIGC0_PRIDC0_EPCC0_CAUSEC0_SRC0_COMPAREC0_TLBHIC0_COUNTC0_BADADDRC0_WIREDC0_PGMASKC0_CTEXTC0_TLBLO1C0_TLBLO0C0_RANDC0_INX::::::::::x:p:h:`:X:P:H:@:8:0:(: ::::99999ؿ9п9$f31$f30$f29$f28$f27$f26$f25$f24$f23$f22$f21$f20$f19$f18$f17$f16$f15$f14$f13$f12$f11$f10$f9$f8$f7$f6$f5$f4$f3$f2$f1$f0;8; ;;;:list trace buffer-tlist only calls-clist only branches-b%c: unknown option %s: unknown option regstyle%08lx: illegal instruction address %s%08lx %08lx ,0x%lx# %d%lx# 0x%08x%ld()# 0x%x%ld, # ]܀Y`__cZ`^h^`Ԁa@a^b|Z8[]l[4YZZa[P[\X\ab bDcX`XYD[]`|cX !%s %s: Event not found. %5d %s addhist: out of memory UU$U4U!U"U#U-U.U/U'UUUUx Up Uh$U`!UX,UP`UHdU@-U8$U00U(AU EUIUMUAUETITMTATETITMTATETITMTTTTTPTTTxXTp\ThT`TXTPTHT@T8T0T(? $T %T@@TD@TH@TL@SBSBSBSBSBSBSBS?FS?F S?FS?F S?FS?F S?FS?F S?F Sx?F  Sp?F Sh?F  S`?F SX?F  SP?F  SH?F S@?F0!S8?F 0!S0?F1!S(?F 1!S ?F2!S?F 2!S?F3!S?F 3!S?F4!R?F 4!R?F5!R?F 5!R?F6!R?F 6!R?F7!R?F 7!R?F8!R?F 8!R?F9!R?F 9!R?F:!R?F :!R?F;!Rx?F ;!Rp?F<!Rh?F <!R`?F=!RX?F =!RP?F>!RH?F >!R@?F?!R8?F ?!R0?F R(?F R ?F R?F! R?F! R?F! R?F $ Q?F$ Q?F % Q?F% Q?F Q?F Q?F  Q?F Q?F Q?F Qx?F  Qh?F QX?F  QH?F Q8?F Q(?F Q?F Q?F P?F P?F PFPJPNP@PDPHPLP P P P P P Px PpPh<P`PXPPPHP@P8P0P(P hPPPPOOOOOO@ODOHOLO@ OD OH OL O@ODOHOxLOp@OhDO`HOXLOPOHO@ O8 O0 O( O  O O'O%O4NNNNNNNNNNNNNNNN? NxNp?8 NhN`<NX*NP(NH,N@+N8? N0N(?; N N?N? NN?: MM>M"M#M.M/M M?4 MM?0 M M?1 M M?2 M M?3 MxMp?6 MhM` MX&MP8MH.wordxorixorsyscallsynctnetneitltutltiutlttltitgeutgeiutgetgeiteqteqidsubudsubsubusubdsrl32dsrlvdsrlsrlvsrldsra32dsravdsrasravsrasltusltiusltisltdsll32dsllvdsllsllvsllsdsdc2sdc1scdswc3swc2swc1scswrsdrsdlswswlshsboriornordmultudmultmultumultmtlomthimflomfhidmtc3dmtc2dmtc1dmtc0mtc3mtc2mtc1mtc0dmfc3dmfc2dmfc1dmfc0mfc3mfc2mfc1mfc0ldldc2ldc1lldlwc3lwc2lwc1llldrldllwulwrlwllwlhulhlbulbluijrjalrjaljddivuddivdivudivctc3ctc2ctc1ctc0cop3cop2cop1trunc.w.strunc.w.dtrunc.l.strunc.l.dround.w.sround.w.dround.l.sround.l.dfloor.w.sfloor.w.dfloor.l.sfloor.l.dceil.w.sceil.w.dceil.l.sceil.l.dcvt.l.scvt.l.dcvt.w.scvt.w.dcvt.d.lcvt.d.wcvt.d.scvt.s.dcvt.s.lcvt.s.wc.ngt.dc.ngt.sc.le.dc.le.sc.nge.dc.nge.sc.lt.dc.lt.sc.ngl.dc.ngl.sc.seq.dc.seq.sc.ngle.dc.ngle.sc.sf.dc.sf.sc.ule.dc.ule.sc.ole.dc.ole.sc.ult.dc.ult.sc.olt.dc.olt.sc.ueq.dc.ueq.sc.eq.dc.eq.sc.un.dc.un.sc.f.dc.f.ssqrt.ssqrt.dneg.dneg.smov.dmov.sabs.dabs.sdiv.ddiv.smul.dmul.ssub.dsub.sadd.dadd.scop0eretrfetlbwrtlbwitlbrtlbpcfc3cfc2cfc1cfc0cachebreakbgezallbltzallbgezalbltzalbgezlbltzlbgezbltzbgtzlblezlbnelbeqlbgtzblezbnebeqbc3tlbc2tlbc1tlbc0tlbc3flbc2flbc1flbc0flbc3tbc2tbc1tbc0tbc3fbc2fbc1fbc0fandianddaddudaddiudaddidaddadduaddiuaddiaddbalbnotdnegudnegdmovenegunegmovelinopslslslstststststslslststststststststststslt(t(t(ttttttLtptttttttttttpWxW`WXW0W WVVVؿVdisplay all fp registersf*set specified fieldreg field valueset specified registerreg valuedisplay all registers starting with tt*display all registers*regsizeerror: arg2 [%s] bad register name Register is readonly warning: 0x%016llx is an invalid 32-bit value error: arg3: [%s] bad field name error: arg4: [%s] bad symbolic value error: arg%d: [%s] base %d value expected error: arg%d: [%s] max value %d expected %*s=WRTEONLY %*s=%s=%08lx %*s=%s=%016llx %*s=%016llx %*s=%08lx %s $%02d- %016llx %08lxdisp_reg: spec==0 %*s: T`$f%-2ld = %08lx/%08lx sp=0.0 (denorm) sp=%e dp=0.0 (denorm)dp=%eC1_CSRC1_FRIDdp=0.0 (denorm) dp=%e bad register number bad arg count $%s-: %016llx : %08lx %s%*.*s +0x%-4lxout of memory Not enough memory to sort symbols, sorry 0x%08lx = 0t%ld = 0o%lo %08lx: not found %08lx = %s %08lx %s[[[[[[p[h[Xlookup address-acompute value-vnumeric order-nlong listing-lbad option [%c] no values specified *Pmon_ftextstartetext$Header: /cvsroot/cvsroot/ssr/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $bxbpb`bXbHb@b0bbaabXaؿaaaaadabXabXabXaxaha`aXaPaHܿaпaHa@a8a(aaa```ؿ`п```````a`p`h```H`@`8`(` ``____п__________p_h_`_X_P_H_8L_ftext etextvalidpc%uleof^Ktrabortoff on tracetracerptcmdhw swswregstyle32 6432regsize86400mfg_loop_maxtime counttimemfg_loop_byauto 8 10 1616inbasehex symbolhexinalphanone XonXoff EtxAckEtxAckdlprotooff on lfeeddlechodiag_log-b -h -w -d-bdataszreboot debugrebootcrashactionl @epc 1brkcmdoff on quickoffbootdiagmodecr lf crlflfulcr9600tty00sysidXP-boot> promptnetmasknetaddrnameserver24moresz(unknown).comlocaldomaintty1hostportgateway00:e0:63:00:00:01ethaddrlink:/pc-flash/boot/bootsourcebootsource2bootdelay0.0.0.0bootaddrbootautoboot%s: bad %s value, try [%s] USER VARIABLES:DIAGNOSTIC VARIABLES:OTHER VARIABLES: %s: not found %s: cannot set variable promsetaddrs1dec0%s=%s: no matching variable %12s%12s = "%s"%12s = %-12s [%s]Invalid value '%s' for environment variable '%s' Baud rate %d too large, max. value is 38400 Illegal baud rate %d baudterminalsetsystempoweron-selftestbootpromlocal-domaintftp-servertftp-gateway/pc-flash/startupError: Config file could not be opened, err = %ld Error: Out of memory for config file Error: Could not open config file, error=%ld Error: Could not read config file, error=%ld Error: Read %ld bytes of config file instead of %ld bytes Console baud rate modified to %d Error: stty(tty0), error setting baud to %s Error: Setting baud environment variable Boot prom's network address modified: %s Boot prom's network mask modified: %s Boot prom's name server modified: %s Boot prom's TFTP server modified: %s Boot prom's local domain name modified: %s Boot prom's gateway modified: %s Power-on self test mode: %s mfg-testPower-on self test mode was %s, now %s onquickPower-on self test mode was %s, now off netmask, NVRAM dump: (%d bytes) 0x%03x: %02x %c WARNING: All variables will be lost! NVRAM reset: (%d bytes) 3840019200960048002400180012006003001502001341107550jxjHj@j(j jjiiiпiȿiiipihiPiHi0disable tandem mode-ixoffenable tandem modeixoffallow only to restart output-ixanyallow any char to restart outputixanyset sane settingssaneset terminal typeset baud ratelist all settings-alist possible baud rates and terminal types-v%s: unrecognized baud rate tty?can't open %s term type %s not found Baud rates: %5s Terminal types: %10s term=%s baud=%s%sistrip -%sixon %sixany %sixoff %sicanon %secho %sechoe %sicrnl %sonlcr erase=%s stop=%s start=%s eol=%s eol2=%s vintr=%s |/-\more... l %s: invalid moresz value lllؿlllllllquitqnext lineCRnext pageSPACErepeat last searchnsearch for str/str %s %snq/ /%s %c %cnؿnnnnnnxnXnPn0n(nnmmmпmȿmmmload from -hset baud rate-uload offset-oignore checksum errors-iload at top of memory-tdon't add offset to symbols-adon't clear exception handlers-edon't clear breakpoints-bdon't clear symbols-ssend cmdstr to host-c cmdstrout of symbol spacebad checksumbad typebad lengthbad charbeastic:u:o:h:hostportrcan't open %s dlprotodlecho%s: unrecognized baud rate Downloading from %s, ^C to abort unknown record type %d errors %3d %s total = 0x%x bytes $lll4lllllTlllDEntry address is %08lx bad termination record Entry Address = %08lx ѤpȀ` ҌrqqqпqqqqqxqXargs to be passed to client-- temporary breakpoint-b start address-e time execution-tdon't set client sp-s b:e:sttime sspshsPsHs(s srrrпrrrrrhstop on reg not equal-R reg valstop on reg equal-r reg valstop on mem not equal-M adr valstop on mem equal-m adr valstop on pc invalid-icapture only calls (jal)-ccapture only branches-bverbose, list each step-vtobad arg count MEMORY%s: bad reg name %c: unrecognized option %s: unrecognized argument stopval table full tttttxtXrtHcommand stringhw bpt for data write only-whw bpt for data read only-rhw bpt for data access-dno hardware breakpoint on R4600Bpt %2d = %08lx too many breakpoints Bpt %2ld = %08lx -> ?? "%s"break address not specified Bpt %2d = %08lx Bpt %2d = %08lx %s [ read write ] *%s: decimal number expected Bpt %2ld not set %ld: breakpoint number too large rvucurrent Status: %08x new SP: %08x %08x: %02x %s PMON %s exception Cause: %08x EPC: %08x RA: %08x BadVa: %08x x鈀鈀鈀x鈀鈀鈀x鈀鈀鈀x鈀鈀鈀x %s Interrupt Exception Cause=%s Unexpected Breakpoint Stopped at H/w Bpt %d Stopped at Bpt %d Stopped: Invalid PC value == != Stopped: 0x%08lx%s0x%08lx Stopped: %s%s0x%08lx %s brkcmdvalidpc variable must have even number of values validpcregsizevinvalid SP=0x%lx invalid PC=0x%lx 0x%08lx+0x%-4lx 0x%08lx0x%llx0x%lx from frame=0x%08lx size=%-4d (alloca=%-4d)stacktrace loop!p44444444444444444444444444444444444444444444444444444444,,44444444444444444444444444444444,,,,444444,,,,client finished normally. No return status available. Attempting to return to monitor. Don't hesitate to 'reboot' if the monitor appears confused. ||p|h|P|H|8|(|{{args to be passed to client-- port to communicate with host-h verbose mode-Vreport protocol errors-vdon't set client sp-s hostportvVsh:hostport=%s can't open %s hostfd=%d 0x1 %c 0x0 0x%x؀ЀЀ؀؀؀؀PutMsg: got type=%s seq=%d, wanted type=ACK seq=%d ACKDATA GetMsg: got type=%s seq=%d msg=<%s>, wanted type=DATA seq=%d PutPkt: seq=%d msg=<%s> ؿпȿENDCSUM3CSUM2CSUM1MSGSEQLEN2TYPLEN1STARTGetPkt: state %s, timeout GetPkt: state %s, restart GetPkt: bad length %d GetPkt: csum error tx=%x rx=%x GetPkt: seq=%d type=%s msg=<%s> GetPkt: state %s, bad char=0x%x pȀ8TTT ac=%d: av[%d]=%s %s %s 0x%x 0x%lx%s %s 0x0 0x%llx%s %s 0x0 0x%lxunknown request type '%s %s %s %s' %s %s 0x%x 0x0 $ll D $llllll ll\llllllllllllll Ԁll 4 Ԁllllll l  lllTRMRPRZRN   x p h`XPH@80hSISUSOSZSVTITUTOTZTVEIEUEOEZEVEECFS????usersupvkernxIEEXLERLKSUUXSXKXIM&SWDECECHSRTSBEVREFRCU ؿпȿVCEDWATCHResvCp2FPEVCEITrapOvfCpURIBpSysDBEIBEAdESAdELTLBSTLBLMODInt  EXCODESWIPBD  RevIMPxph`XPH8DxxxDxxxDDxxxxxDxxDxxDDxxxxDDxxxDxDxDDxxDDxDDؿпȿresvupdexc/wexclnonctuncdwt/awt/na       K0DBIBDCICSEEBEMBESMSCEWSSSBEPECCM PH ASIDVPN2GVDPFNȿ (08xp@h`HXPPH@X80`( hpxؿȿxph`XPH@80(   ؿ ȿ   0( P 8 (ph XP @8 (    п    pXx XhX `H@ 0(  x  ȿ @ HFRIDC1_FRIDCSRC1_CSRCONFIGC0_CONFIGRANDOMC0_RANDOMINDEXC0_INDEXXCONTEXTC0_XCONTEXTCONTEXTC0_CONTEXTENTRYHIC0_ENTRYHIENTRYLO1C0_ENTRYLO1ENTRYLO0C0_ENTRYLO0PGMASKC0_PGMASKTAGHIC0_TAGHITAGLOC0_TAGLOCACHERRC0_CACHERRECCC0_ECCLLADDRC0_LLADDRWATCHHIC0_WATCHHIWATCHLOC0_WATCHLOERRPCC0_ERRPCBADVAC0_BADVAEPCC0_EPCPRIDC0_PRIDCAUSEC0_CAUSEC0_SRLOHI31ra30s829sp28gp27k126k025t924t823s722s621s520s419s318s217s116s015t714t613t512t411t310t29t18t07a36a25a14a03v12v01at0zerocontinuous test-c%c: bad option %s: Unknown argument Testing %08lx to %08lx %s continuousMemory test running..  There were %d errors.  Test passed with no errors.  error: addr=%08x read=%08x expected=%08x  error: adr=%08x read=%08x expected=%08x 0x%08lx-0x%08lx: %s ؿпH0x, default 0x80000000+memsize (16M -> 0x1000000)-e0x, default 1M (0x100000), should be (1 << n)-b0x, default 0x80000000-sbad arg count %s is an invalid address (try 0x12ab) '%s' is an invalid option startaddr is greater than endaddr freeing previous block at 0x%08x (size %d) unable to allocate memory 0x%08lx (size 0x%x) : %s slot %d ('%s') is out of range. Try 1 through 4 (5=nia packet mem) allocalloc must specify a freeslot %d wasn't allocated testslot %d wasn't allocated. Allocating slot %d with 0x10000 bytes. 0x%08lx (size 0x%x) : %s [recorded] 0x%08lx (size 0x%x) : %s [computed] results differ.. computing block by block differences 0x%08lx was: %02x 0x%08lx now: results are the same. Memory is intact Usage: allocmemtest alloc allocmemtest test allocmemtest free foo_cmd: argv[%d]=%s XH8!tc0(<cЀYȿ^zXx`H/80 kp0b\ȀcH8!tc0tH8!tcpmhP-80(VUL0lP&cؿa00q0htl`Pjd@0 p0jc^L0-x]4pXUP@( h<c؀Yп0acp`<P080 @0Aؿ}c0xh@hc`X@58 <.؀4cпVxhFc`X/PH;D@(N|0ȿ:ȿS,0cxhPH((X4ؿпȀ-ȿ2cpXDH(**<0eؿ00P@_0 n lw`x6 c0plh0!пX&cP0@ 80 -transparent modetrreceive packetssumcommand shellshsend packetsend_packetsearch memorysearchdisplay PC-flash drive informationpcshowdrivedisplay PC-flash blockpcshowblockdisplay int-flash blockshowblockoperate PCMCIA[poll, vppon, off, see_common, see_attribute, 0, 1, cis]pcmciaReset NVRAM contents!nvramresetDump NVRAM contentsnvramdumpenable NILE interruptsnileintsset/show board ID + MAC[-i boardid] [-m macaddr]newsystemdump memory to net hosthost startaddr kb startpagenetdumpmodify word[-p [-c]] adr valmwmemory test[-c][[addr] size]mtmodify swab32'ed wordmswmemory md5sum[-s start][-b block][-e end]memsumshow/set PHY registers[addr [data]]mdiomodify memory[adr [val|-s str]..]mdisassemble memory[-bct][adr [cnt]]linitialize decchipinit_decchipset or show idprom dataset|show [addr] [data]idpromflush caches[-di]flushfill memoryfrom to {val|-s str}..filltest Elan hw features[fpga[reg[val]]]][nia_sram]elandisplay word[-p [-c [-s]]] adrdwdump memory to hostport[-B] adr siz [port]dumpdisplay swab32'ed wordaddrdswdiag commands[cmd]diagshow dec statusdec_statusgdb-remote debug mode[-vv][-h port][-- args]debugdisplay memory[-bhws] adr [cnt]dcopy memoryfrom to sizcopytest memory refreshallocmemtestunpack tarfile untarunset variable(s)name* ...unsetunmount internal-flashumountcreate empty filetouchset terminal options[device] [opts]sttydisplay/set variable[name [value]]setremove directoryrmdirdelete filermrebootprint current directorypwdping remote host[-fqrv] [-c cnt] [-s sz] hostpingunmount pc-flashpcumountshow ver of pc-flash VFSpcshowversionmount pc-flashpcmountconvert pc-flash VFS 2pcmakeversion2convert pc-flash VFS 1pcmakeversion1mount internal-flash-imountpaginatormorecreate directorymkdirlist directory[]lsload file with tftp[-bens] [[host:]file]loaddisplay command history[cnt]hihelpshow hardwarehardwarehedit variable(s)name ...eseterase internal-flasherasevfserase pc-flasherasepcvfsget/set date and time[[yy]yymmddhhmm[.ss]]datecopy files cpset current directorycdshow contents of filecatboot from file[-pdvnbk] filespec [kernel-args]booton-line help[*|cmd..]?Hardware inventory: (̀() )((microtime: count=%u compare=%u $Header: /cvsroot/cvsroot/ssr/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $(ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހؿпSatFriThuWedTueMonSunxph`XPH@80DecNovOctSepAugJulJunMayAprMarFebJanbad seconds bad minutes bad hours bad day bad month bad year %s: bad date syntax weekday was %d (not 1..7) BluesDaymonth was %d (not 1..12) %s %04.4d-%02.2d-%02.2d %02d:%02d:%02d $Header: /cvsroot/cvsroot/ssr/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $Error: NVRAM was uninitialised Error: NVRAM had an unrecoverable checksum error Warning: NVRAM had a recoverable checksum error Warning: NVRAM had bad state (%d) ethaddr%02x:%02x:%02x:%02x:%02x:%02xfailed to write MAC bytes 0 and 1 failed to write MAC bytes 2 and 3 failed to write MAC bytes 4 and 5 sysid%ldfailed to write board id sts = %d NVRAM - map - runaway loop (ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހ$Header: /cvsroot/cvsroot/ssr/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $(ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހElan %s=%04x.%04x%s interruptCache Error exceptionPMON %s exceptionCauseEPCRABadVaddrCacheErrJ`JJJJ`JJJJ`JJJJ`JJJJ`JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJp cop1 called KKlKlKlKlKlK4KlKlKlKlKlKlKlKlKlKlKlKlKlKlKlKlKlKlKlKlKlK hostport=%s can't open %s debugfd=%d to allow segfaults: set {int}0x%lx = 47 ; set {int}0x%lx = ~47 passing control to prom-based remote debugger execute 'target remote ' on your host gdb now debugging client finished normally. You should 'detach' from gdb now. gdb may indicate a 'SIGINT' right now. Don't believe it. Detach! ȿɨɐɈh`@8( ȰȠȀargv's passed to the main imagekernel-argsskip webdata and images [tftp boot only]-kbypass image checksum-bload but do not run-nverbose mode-vrun under runtime gdb debugger-drun under prom gdb debugger-p or file:/pc-flash/file or file:/pc-flash/dir/tftp://host.com/filenamefilespec[,...]bkdpnzvtftp://tftp://bootaddrmissing host address and $bootaddr not set /bootsource=Source string '%s' is too long to be passed to the runtime, dropping it source: %s warning: couldn't unmount webdata vfs unmountwarning: couldn't unmount images vfs Kernel not found or lost in transmission Warning: checksumming bypassed. Kernel is unvalidated md5sumversion file didn't have an 'md5sum' entry version file's md5sum was invalid Kernel checksum didn't match that of the version file: image was corrupted during transmission. Kernel invalid. Please boot again. Image checksum validated Warning: no checksum found in version file - kernel is unvalidated boot_version_addr=0x%xboot_version_addr=0x%lxboot_webdata_vfs_ramdisk_addr=0x%xboot_webdata_vfs_ramdisk_addr=0x%lxboot_webdata_vfs_ramdisk_blocks=%dboot_images_vfs_ramdisk_addr=0x%xboot_images_vfs_ramdisk_addr=0x%lxboot_images_vfs_ramdisk_blocks=%dramtop=0x%xdebug=runtimedebug_verbose=%dtty0_baud=%dpromversion=%sclient args: %s flushing webdata ramdiskflushing images ramdiskUm, something went wrong and the file wasn't run Ȁ  ؀ Ѐ short read/short file (read %d, expecting %d) short read (read %d, blocksize %d) Build Host Build location: host '%s' Build Userby '%s' Official Version Version: %s Build Date Build date: %s webdata_vfs_blocks warning, 'webdata_vfs_blocks' was invalid '%s' warning, webdata VFS defaulted to %d blocks, but version file calls for %d images_vfs_blocks warning, 'images_vfs_blocks' was invalid '%s' warning, images VFS defaulted to %d blocks, Loading kernel bad ELF header for 'kernel'.. not an ELF file? Wrong architecture? non-executable ELF file (no program header) too many ELF program segments corrupt ELF file: program header lies beyond end of kernel (base 0x%x, memsize %d, filesize %d) ELF file corrupted: segment %d attempts to load beyond real memory warning: ELF segment %d (0x%x - 0x%x) overlaps prom code (0x%x - 0x%x) problem: segment %d starts at %d, before segment %d at %d  %3d%%%4dk 100%% - kernel loaded /tftp-webdatacreating directory unable to create %s touching ramdisk file unable to touch %s creating ramdisk filewriting to VFS file/tftp-images File: %s (%d bytes) File: %s versionkernelwebdata/images/ %s: unknown file, ignoring error, no memory to create webdata filesystem creating webdata ramdiskerror, no memory to create images filesystem creating images ramdisklink:using link: bootsource link pointed at %s linkfile didn't exist, looking for single /boot/ directory /pc-flash/bootfile:/pc-flash/boot/%s/single directory %s found no suitable image found file:bootsource,All bootsources failed. Aborting boot. Rebooting bootprom. . . bkdpnzvfile:Error: source '%s' must begin with 'file:' Error: pathname '%s' must begin with a '/' -vbootsource=Source string '%s' is too long to be passed to the runtime, dropping it source: %s Error: couldn't load ELF file '%s' versionError: couldn't read 'version' file in %s, error=%ld Error: out of memory for version file Error: couldn't open version file, error=%ld Error: couldn't read from version file, error=%ld Error: didn't read all of version file Loaded version file kernel Error: couldn't load ELF file '%s' Warning: checksumming bypassed. Kernel is unvalidated md5sumversion file didn't have an 'md5sum' entry version file's md5sum was invalid Kernel checksum didn't match that of the version file: Image was corrupt. Please upgrade your image. Image checksum validated Warning: no checksum found in version file - kernel is unvalidated boot_version_addr=0x%lxramtop=0x%xdebug=runtimedebug_verbose=%dtty0_baud=%dclient args: %s promversion=%sUm, something went wrong and the file wasn't run 񦘀x񦈀pError: couldn't determine size of kernel, error=%ld Error: couldn't open kernel, error=%ld Loading kernel error during read: bad ELF header for 'kernel'.. not an ELF file? Wrong architecture? non-executable ELF file (no program header) too many ELF program segments corrupt ELF file: program header lies beyond end of kernel (base 0x%x, size %d) ELF file corrupted: segment %d attempts to load beyond real memory warning: ELF segment %d (0x%x - 0x%x) overlaps prom code (0x%x - 0x%x) problem: segment %d starts at %d, before segment %d at %d error during read: short read: got %ld, expected %d  %3d%%%4dk 100%% - %s: %d bytes%s (dir) %s: %d bytes ========= short read tftp://bootaddrmissing host address and $bootaddr not set remote pathname too long :opening tarfile from %s couldn't open %s for reading couldn't read a full tar block tftp file had .gz magic but insane flags. 1.0.4error, couldn't init compression wow, .tar.gz file was < 512 bytes total. tftp: zlib error: %d nuisance, inflate() wants multiple passes kernelustar ustar00tar: bad magic '%c%c%c%c%c%c%c%c'. Not a tar file? tar: bad checksum %s not a normal file or directory, skipping tftp tar: seeked too far tftp tar: error seeking to next file couldn't malloc additional buffer to push chars back couldn't malloc buffer to push chars back problem, zlib needs feeding but tftp is empty Usage: tar list|cat tftp:[//1.2.3.4]/foo.tar lists members of tarfile retrieved by tftp listcat'%s' must be one of 'list' or 'cat' tarfile contains invalid filename '%s': must be relative path / creating directory %s/ creating directory unable to create %s touching ramdisk file unable to touch %s creating ramdisk file Error while reading: count=%d, errno = %d short read writing to VFS file %3d%% 100%% copied %s into VFS invalid directory prefix '%s': must be an absolute path untarring tftp file.. kernel tarfile takes 6 minutes, be patient /pc-flash.vfs_get_statsFailed to initialize the File System - code %d Verifying the file system . . . Verify Failed - file system is corrupted (code %d) . . . (ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހ/vfs error in %s: Bad argument Component length exceeded %d Component is null Bad free block signature Bad VFS block signature Bad directory block signature Bad file block signature Bad directory entry signature Bad file entry signature Bad extra entry signature Bad free entry signature Bad cache buffer signature Bad signature Current entry is not a directory Current entry is not a file Directory is not empty File is still open Bad count for number of directory entries Bad block number Bad entry number (entry not found) File system is full Free entry is not available Free block is not available Bad entry number No free cache buffers Bad cache buffer Error creating VFS on disk Error opening VFS from disk Error reading VFS from disk Error writing VFS to disk Out of memory Given path is not an absolute path Bad path Directory already exists File already exists Attempt to read beyond end of file Bad file size Bad offset NULL Pointer Error closing file Bad VFS handle VFS handle not found Bad mount point Error opening file as mode conflicts Bad mode for open Bad open file list Bad open file signature Bad open file node Error getting lock Error releasing lock Error flushing file No more entries in directory Cache buffer is in use Bad cache buffer in use count Bad file open count Internal Flash Corrupted Unknown error %ld PPPȀP܀PQQQ,Q@QTQhQ|QQQQ̀QQRlRRR0RDRXRlRRRRRЀRRS S S4SHS\SpSSSSSԀSSTT$T8TLT`TtTTTTĀT؀UUUTrwxrw-r-xr---wx-w---x---Sorry, root filesystem is missing, can't do this command mkdirum, you *really* don't want to do that. rmdir%04d-%02d-%02d %2.2d:%02d:%02dls%c%s %8d %20s %s*%8d %20s %s(%d)%8d%10.10s %20s %s/ touchcatFile Block ========== signature : %c%c%c%c block number : %d (0x%x) flags : %d (0x%x) next block : %d (0x%x) parent directory: %d (0x%x) data count : %d (0x%x) data : ===========Decimal and Hex Dump============ (%u)(0x%x) dumprmmvcwd: %s cdthis prom not compiled with MLS_DS1286_FAKE_NVRAM /int-flash-iWARNING: /int-flash is already mounted mounting internal-flash and initializing it too (takes 6 seconds) mountmount successful WARNING: /int-flash is already unmounted umountumount successful WARNING: couldn't find intflash Found flash at 0x%x Attempting to erase upper 1MB of internal flash memory... WARNING: erase of sector %d failed with rc %d erase successful. flushing internal-flash vfs system vfs flush %2d%% writtenexternal flash card%s absent %s not recognized mfgid: %08lx, devid: %08lx WARNING: flash not initialized. Use 'pcmount -i' to initialize WARNING: couldn't create flash handler.. flash badly corrupted? WARNING: /pc-flash is already mounted Trying to mount %s in slot0 (top)... Trying to mount %s in slot1 (bottom)... couldn't create flash handler: out of memory flash was too corrupted. Use 'pcmount -i' to initialize Unknown create_pc_flash_handler code Mounting %ldMB ATA %s . . .Mounting %ldMB Linear %s . . ./pc-flash initializing pcflash: takes 1.5 minutes per 8MB 100%% written Done -bWARNING: /pc-flash is not currently mounted The pcflash is currently mounted. Please unmount it first with the 'pcumount' command, or use '-f' to override. WARNING: could not find pcflash WARNING: flash card not recognized Found %dMB external flash card Erasingerase of sector %d failed with rc %d .Total Blocks: %ld invalid block number %ld (total blocks: %ld: 0 - %ld) %04X: %02X%02X INT FLASH badly corrupted flash not initialized. Use 'pcmount -i' to initialize PC Flash File System is version %d on PC card type Linear ATA Unknown Version 3 ATA flash card inserted, version 1 for linear cards only PC Flash File System already version 1 Write Failed: Unable to covert PC Flash File System to version 1 Unable to convert PC Flash File System to version 1 PC Flash File System converted to version 1 Version 3 ATA flash card inserted, version 2 for linear cards only PC Flash File System already version 2 Read Failed: Unable to covert PC Flash File System to version 2 Read Failed: Unable to convert PC Flash File System to version 2 Write Failed: Unable to covert PC Flash File System to version 2 PC Flash File System converted to version 2 WARNING: /pc-flash is not mounted %s Not Present This command does not support Linear Flash Devices tftp://Error, malformed filename Error, hostname too long bootaddrError, missing host address and $bootaddr not set Error, remote pathname too long: '%s:%s' :file:Error, source and destination files are the same. '%s' invalid couldn't open %s for reading: rc = %ld, errno = %d couldn't open %s for reading: couldn't open %s for writing unable to touch %s: couldn't open %s for writing: Error while reading from TFTP: count = %ld, errno = %d error while reading file: %4ldk%4ldkError writing to TFTP file: count = %ld, errno = %d writing to local file 100%% copy successful 1.0.4%c%c%c%c%c%c%c%c%c%c: invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatP򭐀򯘀̀\Ѐ򵬀invalid literal/length codeinvalid distance code,܀P$򼈀򽸀򾰀invalid distance codeinvalid literal/length codeunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkĀh(pĀxɠdʸ ˔˜oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeincompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.0.4DECchip revision: 0x%08lx initializing DECchip config registers... init failed init complete allocating buffer memory malloc failed setting up tx_buffer.. setting up td.. initializing DECchip CSRs did reset.. waiting a little bit releasing transmit process... packet should be transmitting now... polling tfd to check for finished frame... buffer came back status: 0x%08lx .. buffer didn't come back xmit: stopped: RESET command or transmit jabber expired xmit: running: fetching transmit descriptor xmit: running: waiting for end of transmission xmit: running: reading buffer from mem, queueing data into xmit fifo xmit: reserved xmit: running: setup packet xmit: suspended: xmit fifo underflow, or no available tfd xmit: running: closing tfd recv: stopped: RESET command or STOP RECEIVE command recv: running: fetching receive descriptor recv: running: waiting for end of transmission before prefetching next rfd recv: running: waiting for receive packet recv: suspended: no available receive buffer recv: running: closing rfd recv: running: flushing current frame from recv FIFO because of unavailable reveive buffer recv: running: queueing receive frame from receive FIFO into receive buffer HXhx 0@P`reg %2d: 0x%04x invalid MDIO register number. Try 0 .. 20 reg %2d: 0x%04x reg %2d = 0x%04x . Register written. FLASH_read_region: bad gap. chips = %d, skip = %d FLASH_read_word: bad gap. chips = %d, skip = %d unrecognized flash, id at 0x%08x was mfgid 0x%02x, devid 0x%02x error, someone called FLASH_sectorof Warning - The PCMCIA Device in Slot 0 is not supported ATA - Drive Information Table -------------------------------------------------------------------- General Configuration Bit Information 0x%X 15: Non-magetic Disk 14: Formatting Speed Latency Permissible Gap needed 13: Track Offset Option supported 12: Data Strobe Offset Option supported 11: Over 0.5 Rotational Speed Difference 10: Disk Transfer Rate > 10Mbps 9:10Mbps >= Disk Transfer Rate > 5Mbps 8:5Mbps >= Disk Transfer Rate 7:Removable Cartridge Drive 6:Fixed Drive 5:Spindle Motor Control Option executed 4:Over 15s Changing Head Time 3:Non-MFM Encoding 2:Soft Sector Allocation 1:Hard Sector Allocation Number of Cylinders 0x%X Reserved 0x%X Number of Heads 0x%X Number of Unformatted Bytes per Track 0x%X Number of Unformatted Bytes per Sector 0x%X Number of Sectors per Track 0x%X Number of Sectors per Card (Word 7=MSW, Word 8=LSW) 0x%X 0x%X Vendor Unique 0x%X Serial Number 0x%X%X%X Buffer Type 0x%X 0000h: Not specified 0001h: A single ported single sector buffer 0002h: A dual ported multi-sector buffer 0003h: A dual ported multi-sector buffer w/read cash Buffer Size in 512-byte Increments 0x%X Number of ECC Bytes passed on R/W Long Commands 0x%X Firmware Revision %c%c Model Number 7-0:Max Number of Sectors 0x%X Double Word (32bit) not supported 0x%X 13: Standby Timer supported 0x%X 11: IORDY supported 9: LBA supported 8: DMA supported Reserved 0x%X 15-8: PIO data transfer cycle timing 0x%X 15-8: DMA data transfer cycle timing 0x%X 0: Translation Parameters (Word 54 to 58) are valid 0x%X Current Numbers of Cylinders (*1) 0x%X Current Numbers of Heads (*2) 0x%X Current Sectors per Track (*3) 0x%X Current Capacity in Sectors = (*1)X(*2)X(*3) 0x%X (Word 57 = LSW, Word 58 = MSW) 0x%X 8: Multiple Sector Setting is valid 7-0: Current Sectors that can . . . 0x%X Total Number of Sectors addressable in LBA Mode 0x%X 0x%X Ignore --> Bytes 62-255 tuple(%d): 0x%02x first_data at %d: 0x%02x past extended speed bytes at %d device size byte at %d: 0x%02x >T>\>d>l>t>|>ؿB@FPf test CPU Module : [debug|n] where n is iteration countcpu_modtest PCI bus linespcidisplay help[cmdname]helpUsage: diag %s %s diag %s: command not found. Try 'diag help' for help. %-*s %-*s %s %-*s %15s %s *%s: command not found diag subcommands: %-*s %-*s %08x -> %08lx: bit %d ok BIT %d BAD Error: the pci bus test failed. Run 'pcibustest' for details abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 ledsuartnia_memext_flashint_flashethernetcpu_memcache_funccache_sizepci_busmemory aliasing test : memory mismatch @ %08lx : expected %08lx ; got %08lx walking 1's test : memory mismatch @ %08lx : expected %08lx ; got %08lx walking 0's test : memory mismatch @ %08lx : expected %08lx ; got %08lx I-Cache %d KB, linesize %d. D-Cache %d KB, linesize %d. L2-Cache %d KB, linesize %d, L2-Cache %d MB, linesize %d, enableddisabledcache %s. L2-Cache not detected. I-Cache size mismatch : expected %d ; got %d I-Cache line size mismatch : expected %d ; got %d D-Cache size mismatch : expected %d ; got %d D-Cache line size mismatch : expected %d ; got %d S-Cache not enabled. S-Cache size mismatch : expected %d ; got %d S-Cache line size mismatch : expected %d ; got %d T-Cache not enabled. T-Cache size mismatch : expected %d ; got %d T-Cache line size mismatch : expected %d ; got %d %08x -> %08lx: pci bus bit %d : OK pci bus bit %d : BAD PCI Bus : Walking 1's Test : FAILED @Couldn't allocate tx packet memory Couldn't allocate rx packet memory xmit pkt size 0x%x -Packet sent: %02x rcv pkt size 0x%x -Packet received: check dec : packet length mismatch check dec : packet length : OK check dec : packet data mismatch check dec : packet data : OK check dec : timed out waiting for packet Did you attach a loopback connector to en0? NIA Queue Memory (SRAM) : FAILED NIA Network Memory (DRAM) : FAILED cpu_core : start = %08lx cpu_core : end = %08lx cpu_core : size = %08lx Problem in cpu memory sizing? Uncached memory test failed -- Check DIMMS Cached memory test failed -- Most likely a problem with primary/secondary cache Cached memory test failed cached *0x%08lx: 0x%08lx uncached *0x%08lx: 0x%08lx Couldn't allocate memory for cache test Initializling Cache Writing to Cache Setting cached addr 0x%08lx => 0x%08lx Unexpected cache flush @ addr 0x%08lx Flush back first line Cache flush failed @ addr 0x%08lx Flush back second line Writing Direct to Memory Setting memory addr 0x%08lx => 0x%08lx 1 Unexpected cache invalidate @ addr 0x%08lx 2 Unexpected cache invalidate @ addr 0x%08lx Invalidate the First Line Cache invalidate failed @ addr 0x%08lx 3 Unexpected cache invalidate @ addr 0x%08lx Invalidate the Second Line check flash/int-flash/prom_diag/int-flash/pc-flash/prom_diag/pc-flashExternal Flash Not Present, Mounted Incorrectly or Corrupted External Flash Detected Unknown Flash Mode file %s, already exists creating file %s prom_diagCouldn't open for writing : %s Couldn't allocate wr buffer memory Couldn't write file Couldn't open for reading : %s Couldn't allocate rd buffer memory Couldn't read file check flash : data length mismatch check flash : data mismatch check flash : data OK * Please verify display on UART2... UART2 TEST STRING: * Please verify display on UART1... UART1 TEST STRING: * Please verify that LEDS toggled %s debugshow Current Test Selection : clearreset%% Illegal Count Specified diag cpu_mod [debug] [+] [-] [#] [n] show : Show current test selection clear : Clear all current tests reset : Reset to default selection + : Add test - : Subtract test # : Test individually; ignore global test selection Tests Available : >>>>> CPU Module Test (0x%x times) <<<<<< >>>>> CPU Module Test <<<<<< >>> Iteration 0x%x PCI Bus Check : OK PCI Bus Check : FAILED Cache Size Check : OK Cache Size Check : FAILED Verify HW and SW versions for Cache Sizing Cache Functionality : OK Cache Functionality : FAILED CPU Core Mem Check : OK Cpu Core Mem Check : FAILED DEC Ethernet : OK DEC Ethernet : FAILED Internal Flash Check : OK Internal Flash Check : FAILED External Flash Check : OK External Flash Check : FAILED NIA Mem Check : NIA Mem Check : FAILED The following tests failed attempt to load into PROM space attempt to overwrite monitor code attempt to overwrite monitor data attempt to overwrite monitor bss attempt to overwrite monitor heap attempt to load outside of memory + 0x%x/%d read failed (corrupt object file?) segment read not enough memory for 0x%x table cannot read %s table sym header bad sym header%d syms string symbol table corrupt string pointer only room for %d symbolsLoading ecoff file: %s seek failed (corrupt object file?) not enough memory to read section headers section headerssymbolnon-executable ELF file (no program header) too many ELF program segments Loading elf file: %s program headerxsd.....x.`.X.@.8.(.-internet host name, and file namehost:pathload symbols-sonly load symbols-ydon't clear old symbols-ndon't clear exception handlers-edon't clear breakpoints-bbesnybootaddrmissing host address and $bootaddr not set bootfilemissing file name and $bootfile not set remote pathname too long :%s: invalid executable object file %s: boot failed Entry address is %08x |<|d|d|D|d|d|d|d|d|d|d|d|T|d|d|d|d|L|d|d|d|d|d|\boot-\|/  tftpudptftphosttftp: missing/bad host name: %s tftp: bad internet address: %s octetfile closedsendto(eof)tftp: sendtotftp: selecttftp: timeout, retry %d tftp: recvfromtftp: %s tftp: discarded %d packets netaddr Note: network not usable until $netaddr is set 0.0.0.0ifconfig: socketnetmaskbroadcastioctl (SIOCDIFADDR)ioctl (SIOCAIFADDR)gatewayroute add gatewaygateway %s: unknown host lo0netaddr lo127.0.0.1netmask lo0xff000000ioctl (SIOCAIFADDR) loopbackroute del loopbackroute add loopback%s: bad value for $%s Rc:dfg:h:i:l:np:qrs:vping: bad number of packets to transmit. ping: %s ping: bad groupsize value. ping: bad timing interval. ping: bad preload value. ping: packet size too large. ping: illegal packet size. ping: unknown host %s ping: -f and -i/-g incompatible options. icmpping: unknown protocol icmp. ping: socketping: record routePING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom,󕔀ЀD󖠀󗼀Hdping: sendtoping: wrote %s %d chars, ret=%d ping: packet too short (%d bytes) from %s %d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (same route) RR: NOP unknown option %x--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %ld.%03ld/%u.%03ld/%ld.%03ld ms Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set Source Route Failed Dest Unreachable, Bad Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Bad Code: %d(New addr: 0x%08lx) Echo Request Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply Bad ICMP type: %d 󪈀󪜀H\$|󬠀󬴀Ȁ܀Ԁ$Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) usage: ping [-fqrv] [-c count] [-s size] host ping%d: serial: %ld != seqnum mysum 0x%08lx != theirsum 0x%08lx sum done sum: socketsum: bindping: recvfromsumdec0shutdown: socketshutdown: SIOCGIFFLAGS shutdown: SIOCSIFFLAGS Usage: netdump host <0xstartaddr> dumping %d kb starting at page offset %d from base 0x%08x unknown host %s netdump: socket failednetdump: connect failed %d done %d.%d.%d.%d%u.%u.%u.%u.in-addr.arpaicmptcpudp???п? ?п? ? ? ???%?%?C?D?E?o?o??x?p?h?`?XbfstalkcmdshellloginexecsunrpctftpbootpcbootpstimetelnetftpdaytimesinkdiscardechotcpudpLOCALDOMAINNAMESERVER ܀Ԁ̀%.*s.%.*sB BAAؿANo address associated with nameUnknown server errorHost name lookup failureUnknown hostError 0%s: %s Unknown errorJJIIпIIIIpIXI@I(IHHؿHȿHHHHxHPH@H0HGGGGGGGxG`GPG@GGFؿFFFxFXF@F FEEпEEEhEPE0E EDDDDxDXD@DCCؿCCCCpCXNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedConnection timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0Unknown error%s: %s 8HXdp℀decwarningwarnpanicnoticenoneinfoerrorerremergdebugcritalertlocal7local6local5local4local3local2local1local0uucpusersyslogsecuritynewsmarkmaillprkerndaemoncronauthprivauthloglevelbad $loglevel variable dec0procspawnzombie exit Prom aborted - restarting. . . process %d (%s) dying from signal %d nonamepmonprocreset: couldn't kill all processesnested syscallnetaddrhostnamepmonnot enough memory for networkkmem_malloc: request for %d bytes fails kmem_suballockmem_freeMhM`MXMPM@M8M0M(DEBUGINFO NOTICE WARNING ERROR CRIT ALERT EMERG%s: PANIC: %s %s table is full PȿPPPPPPPPPxPpPhP`PXPHP8P0P(P PPPPOOOؿOȿOOOOOOOpOhOXOHO8O0O OOOONNNпNNNNNNxtempunused 51unused 50unused 49unused 48unused 47unused 46clist dataunused 44buffersubprocproclockffile descfileVM pgdataVM pagerVM pvmapVM pmapVM objhashVM objectVM mapentVM mapshmmapmemUFS mountUFS quotanamecachevnodesNFS mountNFS reqfhandlemountiovsessionpgrpcredsuperblkioctlopsgprofnameisonamesooptsifaddrzombiefragtblhosttblroutetblpcbsocketdevbufmbuffreemalloc - bogus typemalloc: allocation too largefree: multiple frees, type=%s free: multiple frees 0 pausepsignal sigtsleepsetruntimeout table overflowdup2: fdallocEE|EEEĀFFfstatfilefdcopyclosef: count < 0select\`\\^`Tacceptsofree dqsoclose: NOFDREFsoaccept: !NOFDREFnetionetconnetclssbappendaddrsbappendcontrolsemi-panic: sbcompress sbflushsbflush 2sbdrop  mbinitmb_map full m_copymm_copydatap20123456789%s%d: can't handle af%d 0123456789abcdeflolooutput no HDRlo%d: can't handle af%d Mask for route not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %x at %x rn_delete: Orphaned Mask raw_usrreq؀欀欀4搀D砀搀欀Ȁ܀rtfreertfree 2rtrequest deleteroute_output0ĀĀH䨀hLdroutearpresolve: no free entryarp: ether address is broadcast for IP address %s! duplicate IP address %s!! sent from ethernet address: %s in_controlCouldn't unlink inifaddr from ifp Didn't unlink inifadr from list cksum: out of data hN@9`C@Chaf,W\i4ah[p[]h_h0[]h_h[p[]h_interneticmp_erroricmp len5 5 5 1Ԁ2 35 5 25 5 112Ā5 25 3L5 2ip_init(@AAA==(A*MMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMЀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀMMĀMĀMĀMĀMĀMĀMĀMĀMĀMĀX XXX@XdYXYdYpY|Yrip_attachrip_detach$udp_usrrequdp control data unexpectedly retained ikj0k\j\k\jjkdjkklkTkdk\k,k@k\k\k\k\k\- %s: illegal option -- %c %s: option requires an argument -- %c dibouxcsefg% dobxurwr+ ({[<)}]>vt100tvi9200@̀Ԁ,|ttyxdevinit: ERROR rxq NULL /dev/tty =%c%c.0.2[%d;%dH[?25l[?25hdobxXulscefg%(null)dobxXueEfgGNaN-InfinityInfinity@$?zG{xʤȬʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤʤxXȬ@$@$@$?6C-@$@$@$@Qcreate: size %d not a power of two QputQgetEB*X*h3H3333H3333H3334@3P348d8d0d dd8d0d@d8d0dXad8d0dXad8d0dXad8d0dXdhd8d0dXdxd8d0dXdhhhhhhhhh h h h hx hphh o0o oon,./"Z<(!x<@( @(  t0*t+,-Ѐ-|,`؀"5pEXBȀ?8ECxEPFFKNMMlǸN|NOOPh`XPH@80w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- deflate 1.0.4 Copyright 1995-1996 Jean-loup Gailly            inflate 1.0.4 Copyright 1995-1996 Mark Adler  #+3;CScs !1Aa  0@` ??      1x (5  xp`P@(p  @  @xph jUXkdpt4F9K 8ߪÐ|\{=ѫӗn>$c_JJJJJJJJJJJJxK KxPKpHKhK`KX0KPKHK@8K0 K((K K@KKKJJJJJVUؿVX W0X 7Apr 10 2003 13:18:37prom-E3.3.0.0[X[ vfprintf: out of memory?C0' =e -<d =sh$߿ '('XPH < @<d =s[@< =e6d$<d` =$ <#  =lX'$$$$BC$$v$$ =^&0BPR$PQ$$$BP$` -< =e6d&X<'$ <$< <+d&$$$t<"-$@$ca$B$<"`<"<"P<< :<" 8 <N4cC(?B$C`<$c`''80(@<<$<<<<*$<d)p<B<: =e6$<c<$'b2020<<<4c$@ -$<d)<<< ]*BC!<d)<<- =e6<d*<d*< =e6d)<< <4c$@ -$<d*<<< ~*BC!<d*8<<- =e6<d*2"@<d*< =e6d)߿8߱0߰('@'0-$B% $ -'| <0t0-@<< =e6d.< <1(-ptC+@pt<UC+< =e6d-<[$' B#b#pd+`3<fp' @(-$p+@ b+$+@$+@< =] -p$ <>$ -'| <0t0-@ << =e6d.tpC+@tpC+@-< =]-߿ߴ߲߳߱߰''xh-`$S*xpXP@!($-$s'($U&RS*@%&<"< =e6d.<$ <G -@"$&1&RS*@&(@<$,04(@ 8@-<d/0@(- =e60-<-<d-<<d/ =e6$߿ߵxߴp߳h߲`߱X߰P''$ (P@$< -< =s< =s< =s$߿ '('@- -$*@-($ -$ d$ i%K@$C!E<66<d/<H!B$cC!B@<$<d/ =e6<$$*@$R$2@ - <(-2@$ <(--߿(߰ '0'-$ E <@(-߿ '('-$ E <@(-߿ '('-$ E <@(-߿ '('``-X-P-h-$x$Bp$h< <@ -<d0 =^/ (-V PU$T$<<<I@ -<c<$bB*@$Q!E$b<"< <G'@@$<c<Q!E$c<#< <G'DP@$<c<r*@Q!P$b<"<<< <(d,x@-<B<R*@$ - =d$@-$<d, =e6(-<'$`$ - =lX' @< =e6d0(<'$@D<" - - =lX'  -$' "0B0c =lX"< <(d0H<d0P <(@-@-<d0X =i -@<<f0`<d0h =i -<f0x@<f0pD@?<f D,b @$ `-&-@C0Bb!&.@ -<d0&& @ =g-@ @ -<d0&R&&1&f! =g0+@@ -<d00'0 =g8- =j  -$BB! -(- =sPW0#@DT!t#@`ůD<f  -<d0 =g0- =j  - -(- =sP@0- =j  - -(-@0- =sP =] --߿߾߷߶ߵxߴp߳h߲`߱X߰P''0-8 <G' @5$ <G'$@0$ <G'(@+$$ +@($b`!($ $$$b <*e($b`(<p-(! !<l$$ $$b$ <*e($b`(-߿8߰0'@'`-X-P-0<f1<B -phH@8 <+$@-C $ <( -<d1 =e6@(-<3$B$V*@R-<f2&%$-b4@C$ (-"D!B$B,b@W!B@<$<$<$<$<-$$<b!D!E<d.<$U!B$D!B@<&R`$b'$<' <G@&s<3$%<d1<&RV*@&1`< =e6d1<3$ -<f - =j-$F@ $. =_wP@&@<d1<d =e6<3-$ =lX0-$($V'( (-D <#'(@-<d1(- =e6<3$<f1*r - <>0-0-@ $ - <0t(-@ --߿p߷h߶`ߵXߴP߳H߲@߱8߰0'x'X-h-H- -'0'@xp`P@b$ce*@$` -<d2X =g0--$$'0T` - =i$ 6*"@$" ` -<$"4` -<<d2` =g' <` -<d2h =g' <` -<d2p =g' <` -<d2x =g' ` - =i' Q!*B@!<d2 =i` -'0'@0 =_w -@$.(- =i` -&12*@&߿x߶pߵhߴ`߳X߲P߱H߰@''X-- <G'p@$ <G't@$tpC+@~$$3+@"' & < =id-@&13+@T&P@&1$B@&R<&1 <G'x@G&1{B&R3+@&' B#$b,B@$b;p0B@7t0B@3$ b(b@$b<$b << (!!b(!<(!!C(!"C(!#C(!pt+@&-pt$B@ -+`p<@-< =e6d-<@$pt+@' $+P@' pt$B@(-+`p - <(--߿߲߳߱߰''(-0 <Y' @$<U-ߣ <?߿0߰('8'- #$(b-$( =h - - =j @-"!$B =ir - =j  -Q!@"S<d2 =k -@-'  (- =j-0#' <Y' @2' <Y&@.$+bߢߣ<C-ߢߣ<C/<d2 =k -@-''  (- =j-0#' <Y' @' <Y&@$*bߣߢb8<Gߣ`< =e6d2<-ߢC` B<$#$^b$@'&1 <Y (-@-<<xd2ߢ<?B<~Bb @ -&1 <" (-@--<d1<x<d-0 =i -@$&<d2 <"@ -<~@-$ '&1 <&) (-@-<| =_n@?< <+d2@-$b(bP@$`@ -<"b$b@ -<"@ - (-<$  (-<$@ - (-<$ (-0- =[<)@-< <(d2<d2<mU-@ - (- =[0-@-N-< <(d2<d3 (- =e6@0-<-$ =_@1'<f3( <+ -@-`$@ - (- =[$@-1-' <&) (-@-(<<x b' <&) (-@-!-@ - (- =[$@-<<x <( -<d30 =e6@(-<- <&) (-@-<d2 =e6 (-<-B-߿ ߲߳߱߰'(8-0-$$T@,$T@,$( @-'8-@-X-$ph`PH0(B $$$$<$< =e6d3h<$$2*@$$< =sd3H@<$< =sd3P@<$< =sd3X@$<կ$< =sd3`@&12*@&`Y<d3 =e6-<<f<d3 =e6`(--`-@^#D@@2W!E< =e6d.$ $ < (-@2@<@<< d3<d3 =e6<"$<d3@<d3 =e6@b(!&B,B@<d3 =e6&<)&<d3 =e6&&*@@<d0p =e6&s*b@Y<d4 =e6-<<f <d3 =e6`(--`-@W#E@@2V!E< =e6d.2 < (-@2@<_@<<dd3<d3 =e6<"$<d3@<d3 =e6@C(!$B$B<d3 =e6&<&<d3 =e6&&*@@<d0p =e6&s*b@$U-<d4H =e6-<<f0<d3 =e6`(--`-@W#G@@2V!E< =e6d.2 < (-@2@<@<<d3<d3 =e6<"$<d3@<d3 =e6@@b(!<d3 =e6&<&<d3 =e6&&*@@<d0p =e6&s*b@-߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x<B<c 8'h-X-`-8-P-H-@$xp0<?$W*@I $t&$-b*@;$(-D!C$cg (bd@$bg$<+~$<+<2$<2&1D!E<d;@<LU!B$D!B@<Q&R $"'$<I' <G@ &1<$<d;X =e6<$&RW*@&< <+d;p@ <dB4x<":<dB7x<e<dB5<":<": -$ =lX0-<?$ <h -<-4c <#b+`0@*"< =e6d;<$@ $$b < -@$$$(`<< =e6d;<f'(*1`< <* < <͏ @$ <1(- $B< < =] < -0-  $ - <0t@(-T@ -`<< =e6d;<߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0'<B:'hp-xh<&:@-<dB4x<": -(- <&Y$ @ -<d; =g0-<:<d; =g'  - =i' <: <>@- =j D@-E<  - -<d; =i-(B@&C ,b&@<"-"<0@<B:0B|<(-9H =i - -<f; =i(-<B:C0B|<(-9H =i - - =i(-<B:0B<(-9H<j<B:0B|<(-9H =i -<d; =i -<B:C0B|<(-9H<j<B:C0B|<(-9H =i -<d; =i -<B:0B<(-9H<j<B:<c:0BC!E =i - -<f; =i(-<B:<c:<0B|<B:<c:0BC!E =i - -<f; =i(-<<B:<c:0BC!E =i -<d; =i - <( -<&<B:<c:0B<<B:<c:0B|C!E =i -<d; =i - < -<&<B:<c:0BC!E =i -<d; =i -<B:<c:<gC<B:<c:C<Y0B|<B:<c:0BC!E =i -<d; =i -<B:<c:<gC<B:<c:0BC!E =i -<d; =i -<B:C0B|<(-9H<j<B:<c:0BC!E =i -<d; =i -<B:C0B|<(-5<j<B:<c:0BC!E =i -<d; =i -<B:C0B|<(-5<j<B:<c:0BC!E =i -<d; =i -<B:C0B|<(-5<j<B:<c:0BC!E =i -<d; =i -<B:C0B|<(-5<j<B:<c:C0B|C!E =i - -<f; =i(-<B:<c:0BC!E =i - -<`(-<B:<c:C0B|C!E =i -<d; =i -<B:<c:0B|C!E =i -<d; =i -<B:<c:0B<h<B:<c:C0B|C!E =i -<d; =i -<B:<c:0B<h<B:<c:C0B|C!E =i - -<f; =i(-<B:<c:0BC!E =i - - =i(-' <:<d;1 =g0 - =i'  -<:<d;1 <C0<&<B:<c:0B|C!E =i - -<f; =i(-C $b<B:<c:0BC!E =i - - =i(-<B:0R0B@<B%' $B!(- <&Y0-@ -' <d; =g0- - =i'  -<d; <C0-<&' <:<d;<.0<4B' <:<d;0$ =g - =i' <&<4c' <B:0-C$<$B% <&Y@(-T@ -' <d; =g@0- - =i' <d;< -<B:0D$ <c:C!E =i - -<d; =i<B:<c:0B|C!E =i -<&<c:0b@0r<B%<c:0B|C!E =i -<d; =i -<' <c:0b@0r<B%0B|<(-9H<{<c:0b@0r<B%0B|<(-5<{<B:<c:0BC!E =i - -<d; =i<B:0R0B@<B%' <d; =g@0- - =i' <d< =i -<B:<c:0B|C!E =i -<d< =i - -<d< <C@0-<&' <:<d< =g0 -<' ' <d;<:- =g- - =i' <d< =i -r&s =_w@ -@ -<@(-$. =i&*@&߿ߴ߲߳x߱p߰h''H-' @<1:<d;P820 =g0-@ - =i' . @ 2"@<%@ -<d; <C0-߿P߲H߱@߰8'X'@-' 8<:<d;H =g0- - =i' . @ -<d; <C0-߿H߱@߰8'P'@-P-H-.B X@8 =j $<b#' <d; =i -&' `(- =g@0- - =i' ߿X߳P߲H߱@߰8'`'0-(-8<fR(@#H <=3 -@ @ -F <@(-@ -' <0t30$@&߿H߳@߲8߱0߰('P$<";'`-h- -$ ' xpXPH =lX@<B:< :<":@- < -<: <<f =^&@-$$ =j  -<: - <E(#<: <<c:<B:b!$bB$<":<%$# =j  -<: - <E(#<: <<c:<B:b$c(b#b$<#:<B: -V!E =iH- < -<$ - <$<$ <$<$<: << <: =j  ! - <@(-<$<s:<$ <R:! =ir -<: < !< <d< =j  - <$DS*T@&s<$<: =j  !@-<B:!@<R:  -<d< <& < -S*T@e@-<$<: < -<d< <&<: <-<+$<:d*@# < -<n*@Ad#  -<:& =ir !<R: - < ! <d< <& =j  ! <Q !<s:<$ <$<R:! =ir -<: < !< <d< =j  - <$Dr*P@ &s<$ < <d<< - =_w -@ - <&(-< =eN$<$ =lX' ߿x߶pߵhߴ`߳X߲P߱H߰@''P-$XH@ <@ <@ -@- J' =_ (- =ir' =i' @B =j ' $P =ir -&<d< =i' P@'8<B:<d$B@<E!$ E =i -<d<<@(-' =[$ @ <䏤8@ - =i@(-<d<<@(- <' @ - =i@(-<d<<@(-<d<' =e6 <-@ -߿X߲P߱H߰@'`'(-0-8 =j (B@@(-<:0! =i -<: <$ ! =j  - <$D߿8߲0߱(߰ '@'@-$H80b( <G' @ -<$<B -$ =lX0-<B: $P$$<B;<c:$c`$R-<$ -<f1 -<d=<8- =g@0-0-*b@'$ <0t -@ &B$@-<B:$B@&R-߿H߳@߲8߱0߰('P' -(<B:@ <d= =e6&<B:$B<":߿(߰ '0'(- -8 =j 0@-<c:r*@ #!D =eN&<B:$B<":߿8߲0߱(߰ '@' -(<B:@ =eN$<B:&$B<":߿(߰ '0<c;$b8*@-d*@-<B:d #X$BB$$\$B<"-"<B:'08( $P-$<B:<#$B"<'-<dcC!$- =h@(-@&b$<B:`-$BB$-߿8߲0߱(߰ '@'0-8 =i(@T<B:$BB$<(- =i -@E<B:$C(b@<B:b<h<B:@< -<f =_<B:p!$B`(C#C$<": =j  - =_$D<c:<#-"@@ -< =e6d=< =iH (-<B:<;$B(C#C$$<":<$;߿8߱0߰('@'0( @$ - =eNQ&< :<<B:$B<":Ȃ@߿0߱(߰ '8@'$'$"$!Pg$f $P@ $C$<TE$<-@-'' <>B $C,b@<"-"U@<$-߿ '(' <>D ,`-,8B߿ '(' <>B 8B߿ ,B'('(-0 0 <> -B $C,b@ <"-"V0@2@2< %$B<%"!<4B $&"<C$<%C%$0<"-"<<%?-߿0߱(߰ '8$Pb `0?$b $<<-8B <<,B0B8B,B<cP<d=(`<B҈`-$C -$$$C$-<"P<$҈'(-80 2' <(-$ <(-"P- - <@(-$߿8߲0߱(߰ '@'@-- -$ 0- =lXx< <+dW<"T*"@$fEb$Fb<B:< C$@ - <#/@(-<<dW<S<<B< $ @X-< - =j <p-c`@ -$D*T@$<& D*T@ &<P-B@$"*"@$" -<$"$" -< < $<-D< =idWx@-- < --X<c$B`X-< -0T@ &$ <$z$@'  (-'X <8-@&<P-B@&1<f =j  -@ -'X <0t0-<-D =i3$*@$D =i3$?@$-D =kf-<B@3-'('@< - <$zP@%&<(- =iH'(<5@<(- =iH'@ =kf - =kf` -E =j@ -@' E =j@` -@'  (-'X <8-@$&<P-B@&1<f =j  -@ -'X <0t0-<E <Y'`@-<$D =i3$*@$D =i3$?@$- =kfD<B@c'('@<f1-< - <$zP@T&1<(- =iH'(<@<(- =iH'@ =kf - =kf` -E =j@ -@E =j@` -P@8&1<p-c0b@0b <dW =e6$<&1@ 0b<(-ߦ`<P-B@ $<$@$<cTbߥ`<b< =e6dW<p-cߢ`<bߢ`#<?<?b$&1"@&-E< =e6dW<-<B@'--< - <$zP@&D<(- =i@D<(- =i@&<P-B@&1Q!<C-B@E<dW<%<-@--D =iЎ@&@&sS!T!@E<dW =e6<$@< =e6dW<$$ B@hD h C! =iЌE@ h $cD!B@hh C!B@"E <dX =e6<$E =['h@$<dXHF <m$hd8G*@ <dXx$F $ =e6<$Q!<P-B0B @ <(-<P-B@ -<?pS!T!EFh <"'p<(-ߦp<P-B@ $<-S!T!< -EF <"h-߿߷߶ߵߴ߲߳߱߰x''8---Q!< -0@@-<f =j  -cb!$c (cP` -(- <0t0-@$Q!f<8-<dX =g'0< 0 @ <(-<C-B@ -<<?<C-BVQ!<"-"@$<f =j  -@ -(- <0t0-@$-<fRQ!<f$&@ -7(!f <"-"YX@ @5- =j @-#*T@`-&@@-<"}<"}@-$D-8C-8C-8C-D-?'<"|D#$D-8C-8C-8C-D-?'D#<"|$Q$B$@-q*T@ -`-߿H߲@߱8߰0'P$dB'܃8b$g%'(-0 <"' @- C$߿0߰('8'0-(-8 =_n@' (- =[$ @A- ,b P@=-<dc<"C! <" -@-$b <B@* C!<(- =i -@ C!<(- =i -@ $Bb!<#-#`ᯢ C!<"-"T@"<"-"$߿8߱0߰('@'0- -(<f14x8% =i@ -P@&<# -* @&1$߿8߲0߱(߰ '@  <D-B<$@-<4B$+`-<$@-<4B$C%+`-'H-P$`'(hX<fR pB<C$@'0$<B8$$$*TbR'<<&R0<f -<<dYR!CB8?<?(0 =g$P! <#'(@<dY =g -<#r!`F!D&<dY =g -! <#"'0@<dY =g -<#ކ<dY =g -<d< <0t'8@o-<Q!<,B @'8<dY<܄ @ <#0-<dY<܄ H <#0-<#-$ =[$ @2<,b @.(#<dYe($&C0C!e-#d-8e-?C # Bd!)e#<ԜC(#<%L-<-Ґ -#b&$ =i& @--߿0߱(߰ '8<BԜ'8-@0@(<%- <$$@0-(- -<dҐR$r3r+@P -C+T@ -$(@$<%-<Ԝ -!C!CF!Pr+@C+<%&$@ (-*@!B+P@ - F!P<%---߿@߲8߱0߰('H'(-@-H80 <$ (<(>e-#d-8e-?C # Bd!s#C#<-Ґ"b & =i&%@ T.$ <$$<%$ <$ - <$$ =j  -@- =_&D @-&<%- (- =d&F<dcҐC!<cԘDr*`P<2Ԙ<cԜ$$c<#Ԝ߿Hߴ@߳8߲0߱(߰ 'P'(<f1Ґ0&28 $P =_ - &12*@ << <$ - <$$< Ԙ< Ԝ߿8߲0߱(߰ '@' -( <% -@<&7-C$߿(߰ '0' -(-0 <%Q -@(-QV<&T- -<&T$ =iH$-߿0߱(߰ '8'@-H-P-@ -X8 <%Q @-%-B+@!-`& -<dZp =g&<&|$ -<dZx`0- =g8-B'(<dZ<& -<dZ =gB0# -'( =i$߿X߳P߲H߱@߰8'`'(-0 <G' @$ <% @ <<<&-< =e6dZ$߿0߰('8<Ԡ<cԨ<BԜb*@<&-D!B$c<#Ԩ<&<BԤ@B@<dҐ<Ԩ(@E!C$<"Ԩ<#Ԥ`<&<"Ԥ<BԤ<BԜ'@ <&-< Ԩ< Ԥ <$<"Ԡ@< =e6dZ <&߿ '('--' <G@(-@2@ ' <dZ0- =e68-<' <&Y0-@< =e6dZ<'<d[ =e6' ߿߰''- 0<B0@- <&@-J$<fR& - =j@`(-@ @ -<d[  =g 8-@ -' <0t0-@7$ <&@-V&<'$<BԘ$$B <&C$@-'$< @-& - =j@`(-@' =iH(-2!*"P@' @(- =ho$<d =i' <&@-*"PT@&<d' <0t0-@$߿ߴ߲߳߱߰' '8-@-0-(- $*P@-H$ -$ l$v$n$a&bTJ&Rb@$C!E<'61<'61<'61@61@T!B$cC!B@<'&&*@$ -$ =lX0-2"B@@$< =e6d[<'$*@*$-&DPU& <& (-&*@&R<'-@$*@$-&DPU& <'! (-@&*@&R<'-< =e6d[<'$<d[ <'! (--߿PߵHߴ@߳8߲0߱(߰ 'X'<d[<dL <% <Bb5?%)&*T@A$(@$<5n<5o-$T<B;C!<";<c;0Bb!<#;<B;1C!<";$'0-8-@-(<fP -P$$XH<"`<"<"PE =iH$e<dr =i -< < -<dr =^/@(-@-u/t"(bf@$bb$<6$sb$tb$<6<5$<dP< =iHdr<5 -<< <G' @Z$ <"`<5 -<< <G' @O$ <" 8<5 -<c<q*@<fPR!E$b<"< =i -<dr =i -<c<q*@<f <dP =[  -<?<?<"0<08< @` $<6;< : !B&RR!B@!<76&1 <d: <G@0$<75&< =e6ds<7^$&14*@ <܄ 8<; < <=N ?@<7^$ <=-`$$<": <<9 <" =e6-<8i&-$-<C-B@D* &* @$c * @(-<du@E! <0-&@ =e6 0B@< =e6du0 =j  - =_$D@ -<0-$H =iH(-<(-H<du8 =e6-<8f<0- H =eN$ &*@h&4-< =e6du@-߿߾x߷p߶hߵ`ߴX߳P߲H߱@߰8'' -$ <0- =lX-$'`<f@-Ȏ' -<du` =g@0-'  <&Y0-@ - =i' 0B@<du0 =i -<0-H  -<du8 =g'  - =i'  -' <0t0-@& &R*B @&s <f1 #0b@+$ <dux486p$<? =e60-' (- <&Y0-@<du =e6' < =e6du"0B@< =e6du"0B<?@< =e6du< =e6du߿ߵߴ߲߳߱߰''H-*bh`XP@8@R0 &b@P-$$ <f - -< =idu@' <9&1<9L&R =[$ @3 ( @@E!<C-B@U<<9Hdu< -H<#-5@&1 =_<9L&R ނ0B@<9J<du<9H$ <du =e6&1&R&bB*@ -<9[-%< =e6du<9[$ <8-߿h߶`ߵXߴP߳H߲@߱8߰0'p'<`$@80( <B`C$ b-<d <-$$ -< -@ &1R<(-D <*" @& <3`(-<dxh =e6-<>䯠4<6&1 << -@ (-"TP&1&1"T@ 46+P@4&1"@6+4-$6+P@$0,b@@w<"-"y @2?$C,b&@m<"-"z @$24Tbd&1<4B$<h4Tb\&1u+P@Y&1<>#0C,b@Q<"-"z@<>$B0C$b$ TbD&1<>$<$<h<<>`(-Tb9&1(-0D$$T@1&1%4<$<C$$ <=&1<>$<$<TH&1<$<b <$$ <=0#<@#<>ͯ<dx =g0- =j  -!$(&$$,$ - <='(@$(&Lߦ(<dx =g -"h!߿߾߷߶ߵߴx߳p߲h߱`߰X'' < =e6d{< =e6d{X <c߿ '('hP-X-H<fP -h-$h$Vx$sp`E =iH$v<d| =i -< <(d|@-< < < < -<d| =^/@(-@-$g~(bi@w$<@IPv&u$<B$B<"<" 8 <9<" 8$<": <C4ރe<"<< < 0?<"<$<$ b $b < =e6d4.84cEC8-P ?$$(<(>E-C-E-C-E-?#BC!b# #$$<Q5< 5)Q<0@43<>HP ?B@C!C!T(!<>HP ?@C!C!+(!+@0#$B<Q4cCP ?B@C!C!<><Q4cCP ?@C!C!<d4.84cECP (?,@E!b#C#0#<>484cC484cP ?"D#@D!0#<>C$ P ?BC#0#$,<@-,<@- ,@-,b @-- @$ G0B<"-"H$ca$+@-$0B,B@C$<?E$D,b@<"-" @0?(b @(b@0B<"-" < ?<]D0C,b@<"-"À@0B<"-"@l<]<0B<"-"@o<]0<4B$<c 84$8dcd$<?<]DC !<d0cd!B0BD!cBbG<]<<d0cd!B0BD!cBbE<]00B<"-"@0<]<0B<"-"@3<]0<$<C40C$b(bP@$` <]Db$b <]D<B @<C$@ <]<<B @<C$@ <c 8<>b$<?$B<]Db !<B 8<>C$<?$D-' <\@(-0<%(@@ <$<c:<d#b+`<4BE+@$<c:<d!b+`<<4BE+@$<c:<d!b+`<<4<c(<b#+@< b!+@ <4B<c(<Hd!C+@ <B(C<#,$ <]C< (< ,߿ '(<B 0<c;0'( 0B|<?(c`<d =e6(-<d<ܥ 8<>($(< =e6(?<c <b$P@.=<4Bb$<" <]$@!<"-"@<]$<<d 8ܤ<>$<?c4B Tb$d<]$<]$<]$ <]$ <]$ $߿(߰ '0'X-$h`PH@ < 8<c;4$/b $<c;(b <\<><" 8 <_j <]<fp$S@-0B<"-"H<"q2b<"-"H< s<"r <\ - <\<<-<f1۹<<f۸< p <[ -$B,b5@%<"-" @$SB0B<"-"HB2b<"-"H@<_RB<d<^$@<d۹<d <[ $@@"<_- ' L@ <d <@ -< <$<1L@ <dP <@ -<$ <$<1< =e6dh-߿8߲0߱(߰ '@'<dֈ( =e6< 4cB?b*` <4cB? $B b*@< ߿('0'Pp-h-----x$`<fP<< < < -<dָ =^/(-@-S$b,b@*P!B@(e  - T6b  <VFD4cSHC:$\ X ݯ$B -EU* $#Tb$&1"@>-$$.$ - =i3$/@-@(Q#*P@2$R0$"U<.&Q  (-#Tu &Q"C&Q$B`<.&s&Q0-$Bp&s =j-` -p!"T@ -"@ - -$B =j &d (- =iHb-߿`߷X߶PߵHߴ@߳8߲0߱(߰ 'h'(-0-8-$/@ =j @-` - =iH (-&q$<B@(-B @  0-@ $$<#$,B@$? $B,B@ <FRb$4cEHC  -<BB@ @(-<BB@  --߿(߰ '0' <_߿ '('H-8&P -P@B(@ - -C,(-` B C `B&DB,@  (-CC*T`BB &1"*@&DD C $cC/+E-C-?CC# =_B@B<$@B $B@-&DB,@  (-C !b!B &1$B"*@&D-߿P߲H߱@߰8'X'-( C$D(!BL(!@ 0-߿ '(' -0-8("!E@@ & -@(-@r!Ԏb!F<FLb!@4BHb!`܎$B#!܎"0-$B <ͮ" -@(-$<00 <41߿8߲0߱(߰ '@'-( C$D(!B8@ (!߿ '(E!$B'(- -(-08 <-&$#@0-!$(!"<@ $߿8߲0߱(߰ '@'(- -(-08 <-&$@(-#!$0!"P@ $߿8߲0߱(߰ '@'(- -0 <(-#!b!߿0߱(߰ '8' -(0 <\-&@(-L@  0-߿0߱(߰ '8' ( <\-&8` @(-߿(߰ '0' <߿ 0B'(' <߿ 0B'(' <߿ 0B'('0-@-(-H8" @ --"B!b@ b@ - <(-`$<$" &*@&R -߿H߳@߲8߱0߰('P'- @ 0-@8-(-h$c!B0!g*@$ -''- @ 0-@8-(-h$c!B0!g*@$ -''8-P-X-h`H@0" @"-$-"B"b!B@"@- -@(- <0-0BTV&$<)"*@ -" &RB*@&s -߿h߶`ߵXߴP߳H߲@߱8߰0'p((!41b$T$(@ <<@-< <d<>-<f1"$h<fs<DI6RE<fR  -'h <}'8@ -$5PY-8P$-$d =e6` -L0 L@-R-  -(-0-$$,4<D <>L@-- ,@- `\<B;<@< =e6d <<fH& -@ (- -@ $ -@ $<B -B@ $@-<#`<B$<<BBR<dBc,<d =e6@-<BBP<B<~@<BЬ@ < =e6d<-<d( < - <<d$<d @ $߿h߲`߱X߰P'p' -(-(0< =sdX<d =s,Q@ -$<" - <$-߿0߱(߰ '8<' < =e6d< <@<d( <@ -<< =e6d0<  <<d$@ $߿ -'(<B'@ (@ '(< =e6dH< =e6d<9-'( =$<Bz'( b!<4B!S*@<?Q<d<$?Q<d(?) =e6(#`-L`,0<d <>@-0<;l< =e6d<,0<d <(-@-0<[!<d < -< =e6d D` <` <ẏ(< <(T` L` <ẏ,< <,-<d0 =e6-߿߾߷߶ߵߴx߳p߲h߱`߰X'' -(-080V<>V?C#C!# ?C#C!"#X%߷8߶0ߵ(ߴ ߲߳߱߰'@<dBX-`-h-<--@N X'<e%%%%%%%%b&0BN!C bX&d &0 ! bX&e(&0((! bX&f0&000! bX&g8&088! bX&h@&1@@! bX&iH&1) H.H!# bX&jP&1J PNP!C bX&-@% '<d%%b&0BD!C bX& ''$4$<$@$ <䯠,߿@'H'P0-`@-X-8-H-h(@ C$1b$$8<$@$B @@<dBB @(B$@$<dBB$$R$a&$#,B @ $j$&b,B@. @/@$<$D(B @ $@- $<$p0&Q$D"D484c& $$B<>C% $@$253$&($H@?B"LD(B @ $",D(% B @ $"4D(%@B @ $&p(-"8%D(B @ $#,@0-` &"4@"8@@ -<B @ - |7B@!"@E!b! <#߿h߾`߷X߶PߵHߴ@߳8߲0߱(߰ 'p'0-8-(-@ -H@ GG$`$*b`(-<$ 0-D0 <-B0."@8- $Cq+@#`-b!`(-, =d 0-,L,(-`PB&&<bHC&D$<,<L!cHC&D$<@(8$@D!4Gd!g<8@C!E$+@-߿Hߴ@߳8߲0߱(߰ 'P'(-( @!$ @$$@$<$,a @$*$q -$0 <1 < --߿(߰ '0' -0-(-8 (@ @-$R$. @.B@<^$"x@b!@P!<#-#<"-"b@ <$@(-"xP@P!0x<b-c#t<b-c#<b-c#<"-""p2|-߿8߲0߱(߰ '@$f!b$F!E' -0(q+T@`-  =d 0- Q! b Q!b Q!Q#bQ#b@ ߿0߱(߰ '8'(-0-@8  $.B@xE-xE-C-E-?#BC!)@(#$$q <"-"0@@$B$B$bcC0c$b -$ b<dB<$Bb+`$ <dB<$@$B$c$bg*(! < >xD-xD-C-D-?#BC!@b#-$ <dB<0 @$$<@$B-$B$bbb$b@$B-$B$bcBC!$b@$B-$B$bcBC!$b@~$B$B$bdBD!bC$0$<ꬃ$$ <dc<꬀(-D < 0-@-$"$$ C<@"r -(- <$b @-$ @$ca$B-$-<#-$1z0&$B0*@$c*@*$ <#-$1z2&$B2*@$c*@* $<#-$1z.&$B.*@$c* @ $<#-$1z0&$B0* @$c<d1x$ <8' -$- -<1-25 -$' !EBt@ ` -@AEBx@ ` -@;B&1U"*@&<•Cb@-$'  !EBt@ &1BS"*@&C$b@-$' @EBx@  !B&1S"*@&D $C!(,C!D!߿xߵpߴh߳`߲X߱P߰H'' -(0 <-@(-Z$ b - < -<¼ < (-߿0߱(߰ '8'P-H-xph` <X<dhlhl '(/#`@-` #Z$ b - <(-<3"@$#b@>-$' !%"|@ ` -@A%"@ ` -@;"&RUB*@&<'#b@-$'  !%"|@ &R"SB*@&#$b@-$' @%"@  !"&RSB*@&$ $C!(,C!D!߿xߵpߴh߳`߲X߱P߰H''pX-@-H-`- (-xph <P-w$c-,bu@+@ cZ$ b ` -(- 0- <ʎ8-<Ü<Ü$$--,!^&&R !!Ebp@ 0-@%&@^&$&1(+T@-d- $--, !^&!Bb&R&@$$&1(+T@--߿߾߷x߶pߵhߴ`߳X߲P߱H߰@''pX-@-xph`PH <-v$$c',bu@+@ cZ$ b` - <(-<<$$--,!W&&R !!Ebp@ 0-@%&@W&$&1'+T@-d- $--, !W&!Bb&R&@$$&1'+T@--߿߾߷x߶pߵhߴ`߳X߲P߱H߰@''@-P-X-H` <-@@-$ ZbH# -@(-`0- <ɗ 8-<Ĉ  ` -(- =d0@V` - T8-<<0-$$$b%0b%0"d%+@$<Ĉ 8- (-`-'!B$b+@$cHH ?E+@@H2$$$b%b$Y0BC62$$&C%B0DT/ -2$$(C%BT@( -2$$Nb%b$E0,B@2$$XC%BD2$$^b%20$$`0% -(-c <b!VV<;$ - <(--߿PߵHߴ@߳8߲0߱(߰ 'X'H-P-X-@-`80( #$$&$#'$ <&Q2#'$$"% <@-2% -"(- <@-VV$߿`߷X߶PߵHߴ@߳8߲0߱(߰ 'h<dB5<dB1<dB2,<dB2p <dB2<dB2Ȭ'$ <߿ '('@-H-$`(-xph`XP80 <͖,&q $#c6#'Q$$UuU%$C <$Q$tT%$UC <Q$U%$C <&p@ -$#'P$`(-0^ <͖-Q$U%$C <Q$T%$UC <Q$5%$# <%@ -`(- <͖@-$T`w,T`p$$ $$-$߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0''0-@-8-`(-PH( <͖ -B2T$b2$&p $b#'P$$Uqq%$b <P$$bb%$Ub <P$%$ <U <2C0bE 0b @C0bE@ - <͖`(-&1<B<R!Q<>---@< <(d.@-<dx<d.$"0B@$<";l<4$5(2-$#& f*@-#$$*@*@Ā#P*T@@- #$ !`(- =\0-p!"$P#P!"$"$# C*@ " - <" -' <'$@-$" "P!" @#߿`߶XߵPߴH߳@߲8߱0߰('h'@-H-`XP80( < @- $<$"0BC$<#;l<3(%-$$% ŀ#P*T@@- -$e(! =\0-!" P#P!" "$# P!v "$ < -w" -b& <`(-@$ @#߿`߷X߶PߵHߴ@߳8߲0߱(߰ 'h'(- 0 <-@ -$<$*@$ (-<$Q(!$0BC$ <$*@$<";l<$$$߿0߱(߰ '8'H@8 <0@- $< $"2(0BC < -$P" -B& <@(-@.$# b+ < - -@(-"0- <֤<"$# C*@&D"@<f0(-$B =iH@ =j  -@(-$P0-$$,$ =R8-P< $߿('0' $B0c`$N <1(-߿ '('X`--h-$x'Hp'0$$XTT0-$,$ =R8-U< <-$ <@$<d1P =@0-"$Bbr$߿߾߷߶ߵߴx߳p߲h߱`߰X''X`---h-x&$p'P$X(-0-$,$ =R8-T` -< (& $$8<#C< C< C< C< =x<"C< C<$C< C< C<##< < -<d3 =^/@(-@-$b$c,b%@<"-"4@(-<<  -R =$$<"> <@ -$<">C-<2C<| <@ -@- <dx<d4 =]@0- =$"<">"& D =\&' -% =j-$<0C<c=x0b@ 0b@<dx< =]d4 =$<C,@$$<"C*@<dx< =]d3 =$<B=x0B@ $<BC*@<BC$*@& =0B<"C< A< $ =$<B=x0B@4$'<>$ =$<B=x0B @(-$'<>$$'$$( =$A4< 4$ =$$b <<d4<C<C =e6@0-< <C<C< =e6d4<d =$<d =$&s$b$ <&sp<B=x0B@$' <$'0'8'<B=x0B@ (- <'0-<B>8-04$DS =˯$@ (-0-8-<>$'$ =D,A  -<c;l$b< <C<c>$h`XH@8b$< ><$>0d 0cb<d-c='b$<$-#=<BC@&d =(--<BC<cC`/$Q<f>$` -<BC (-`$C<#C <Ҧb<d> 0-<>8-b$ =R,@- < (<BC$"*@=&P$fP"&1<d60 =e6 (-<BC$"*@.&P! -&"C@"#T< =e6d6h<d6p =e6&1<BC"*@&<&&<BC"*@$c<&<B=x0B@ <뒎<d6x (- =e6@0- <@ -&*b@$b(bP@$P`-<b1$b<d6 =e6&s&*B@&&&&&C!D!C!@<d6 =e6&sJh#,@C#C!8#4P 8?9B@G!G!"H# I!@$@E#E! =e60# = -߿H'P' -(,b@<"-":@< =e6d7$@- <⏤4<d=(<d; =g@0-< <⏤4<d=(<d; =g@8-<dB=(߿(߰ '0' ( =e6 (- -&E$ =\P@(-$8-&<K <{&13+@< =e6d><K =-߿`ߴX߳P߲H߱@߰8'h'( <' @$ ߿('0'H-p-`' h$xXP@8-C$0b($ &RC$xb$Xb!$<$,B@  =_n -@t&R0$<Q!2,B@ =_ -@ &  - =_q@&&Q!&RP&2C$.b ',+@3.b@1&R<&D-@7- =_z@3-' #$C$b ,b@'$b $b.b<+<4BS+T@- <*4S+@- $b%<+c%@<.- $($D%C%b%V$߿x߷p߶hߵ`ߴX߳P߲H߱@߰8''(-<<4B8 =g,-߿8߰0'@'`P-$xph`X,4 +@s(- 0-,8- <)$@-k0! =g, -$$ '0$ <󯯢$A'0 @8( =s @$<d>H =s@ -@$<d>P =s@ -@-$<fV0 - =iH@(-<dBV <dcV,P<1V(`<#V$߿8߲0߱(߰ '@'0-<;x8-@( < <@- % =s@ -@0@ =s@ -@&@<`$ =s`(-@<B;x@ - < -߿@߳8߲0߱(߰ 'H< VP$<"VP<VP @E!<dc>XC !@<'-<dV8<dBVH< VL<"V   "#߿XߵPߴH߳@߲8߱0߰('`'@D!D#<dc%`0C!<BϨ@ -PH8@h("#C!C$<"Ϩa<< Ϩ=7$#C!F#0E?@D!@b!$@0$b0€P@&DbH$B= bH$bD0-$BbDB `8-B < $@- < =.` -@(-0- =3@- =. -<4$#"! !@C!#@b!e$"#C!@ %#"!$B !<4"#C!T"#$B"C*P@ <߿PߴH߳@߲8߱0߰('X4B@-' ( <(- @-p*@<<4Bi,VP*@< <4Bi*E=$4Bi $=4Bi+AP*@< <4Bi)0=$4Bi(V?$b0B@@; <@ -=b4Bb"C$b =? -@-*` -"<&%< =A=b0CA$b$@ =? -=@-b =D@ -=% <`@ -=ʦ"%& <@ -=% <@ -=ʦ"%& <@ - =. --߿X߶PߵHߴ@߳8߲0߱(߰ '`' -@P!P#<dc%`(C! -0 =-z =. - =  S%"C$"C$b <"-"Q@0B@`<'C$<$DS%DH= dC$D'C$DB@H= dC$HS% =.H߿Hߴ@߳8߲0߱(߰ 'P(-$$<dQ@0BP@ $P$$DGb%D$( @$' -H@80(HL@!$<fsQ@$ =܎H@-$bT H('E$HS!B0BP@ rDD%D<E$<Q!@H@߿Hߴ@߳8߲0߱(߰ 'P'(- -80"@- =.$b(b@$b<= $$b<= $4B$@b$ %= $@#@'b$= #@4cC$"@ =.@-߿8߲0߱(߰ '@<-'-< dLf@4<dQ4B$(G$8- = Ьb@߿ $'(<;' = ߿ '(' -(-." 8@0 &$< = dQ&$$DC$@2@C$@$HC$+ @<C%<$$ =.@-$b$b = L0B@ = m -= L<B; =  -<B;$ " = $ =.@ -߿8߲0߱(߰ '@' -($0<fRQ@8@<'b $- =@(-$Q 0!Dc$@L!BQ0b@-<'C$= e<߿8߲0߱(߰ '@'0-&C$Hb(<1;'XP@8 "<0LC$"<P!T - =@(-= =. =@-0b@$b$= 3@P!B#@U%b% =.#@@ -0$ " =.0 =3@ =. -߿X߶PߵHߴ@߳8߲0߱(߰ '`' <;0-8-H-P-@-(-h` =.X2w `@-V@$< = dQ$ <d6(- =O0-$<4B` @'b$@- = \ -= @--$ = _ -$= &12"@ = =  =/  T@&1 =. -0b0b@0b= J$#<d6 =(--V &<`@'b$@- = \ -@ &L$ $$= J$-߿h߾`߷X߶PߵHߴ@߳8߲0߱(߰ 'p' 0- = 8-߿ -'(' ( =.- T` =.@ -߿(߰ '0' -0 =.(@-$b< = dQ = _ -$ =. -߿0߱(߰ '8' -0 =.( `@- = m -4B =. --߿0߱(߰ '8' -0 =.(<; p@- = _ =. -߿0߱(߰ '8' =k =߿ '(<c;'0b@ $b$<"; =:<c;0b@$b$<"; =N<c;0b@$b$<"; =%߿ '(<c0'(-0-8` b Q#@b @$c`<;@@ <;%( =$$@ - = $<B;"<d<<c< <4BB?0f !D*<$< @<4B!<"< $c@ =.߿8߲0߱(߰ '@'8<fs0@0( =.e@ - @ =.=H<c<,<%<,b =. - @(-=-߿@߳8߲0߱(߰ 'H'8-0- -H@ =.(@-$<1<, < = dQ"<d023<"<,P p*P@\`#(-$0 P# =. -߿Hߴ@߳8߲0߱(߰ 'P' -(0 =.-<d0@ -TP8-TQ8-` b F!b <c<,<%<,= =.߿0߱(߰ '8'08 =.-< 4c<<0#f*`(@@-<B< #<b4BM@P<;f#f!' ?D#b!/8?E#b@ $A<a =<<;4BD $<A <F*@6 =. --߿8߰0'@'(-0@ - (-#C!R#s!Bp!0BbB $BB "P+T@0-߿H߳@߲8߱0߰('P'P-(-XH@80 B+@-CC!Q =$ BD!,b@<"-"R@,@ - =1' @- CC!QCbd!0Bb" $B" B C*T@C =-c-0c=ծ-d00c %=բd#-$c=ծ -<4f~'$@0-#8-0c3#($B0Bb%#0c@ $@-O -<4f}@0-8-"#B0c@@ $@- -=-<4f~@0-0Bb8-@ $=-# $b -"C&-=ծ<@4tw0-B@ 8-#=ծ# $b-$=դ&# =@=$B -<4tv&B@ 8-=$߿XߵPߴH߳@߲8߱0߰('`'H- ' +@C!d=$ `=E@!0`b!bP@$*T@ => (-߿ '('h-p` $b+@-cC!D$=,$ b =' =$@-< = dR8-' % =$@@--߿p߱h߰`'x'(-80 - =L$ -@(-*T@` -=X*b!bT@$D!@D*T@Q*P@D=[-*@$߿8߲0߱(߰ '@ $C#`0-0#=}$ e#$c` D !@$c$$a$-'(-0-8-(-@ =1' @2<c<<B`(-&1-A&B(B@@ -D = $'@ - = $'߿@߳8߲0߱(߰ 'H' -(-0 $B @=\-A< = dRP -B@  (- - =@--߿0߱(߰ '8'8-P-XH b+@ cC!D+$ 0B@=$ @'@ $$D408,B@ ' @ - ,P$$$# -,-#0߿X߱P߰H'`'@--- Db+@ -cC!S`T$ b0B@= $ C,b @ ,b@ -= $$ = 0-@-=-'@ B (-408$D =0-@-),B+@ -#`!$,C!@,B$+@&1` -B,@ ' @- ,Q$$$#-,"#B,B @- - = $-߿߶ߵߴ߲߳߱߰''X-8-h`PHC b+@ -cC!D0$ 0B@=Y$ @'@ $$D408,B@ ' @-,Q$$$#$ -$ @ - = $ ,-##q߿h߳`߲X߱P߰H'p'@--- Db+@ -cC!S`Z$ b0B@=$ C,b @ ,b@ -=$$ = 0-@-=-'@ (- C$408$D =0-@-.,B+@ -#`&$,C!@",B$+@&1` -B,@ ' @-,Q$$$#$ -$  - = $ ,"#B,B @- - = $-߿߶ߵߴ߲߳߱߰''--- +@ ' C!Q $ "0B@< =$ 4BfB<  !-4c=4BfB !-0c=0S.b@.b=$@` -$ = 0-@--A <@`(- =`0-@-<=B$P@< ` - =`(-=8<< B$@<<4Bf}B#R*@<4Bf|B1$= -4Bf~B<@4Bf{B?$= -@"=R4B"0B" -<4f~'B@ 8-=@-@"=e4B@"0B" -<4f}'B@ 8-=@-# b-"=D&\# -<4tv'B@ 8-=@-# b -"B&-=<@4tw0-B@ 8-@-#=@(-0-B@ 8-@- <@B$@` - =`0-@- - = $-߿߷߶ߵߴ߲߳߱߰''hp-h--'($ x`X =P'8 =$ bcb*T@cbd$BB'( =0@-md', =0@-ed '0 =0@-]d'H (- =$@-T =  -@P$ =.@-<d< =W - =.@ - = -= @-- -'(4B$g<1@-2P@# $=""0B @2="$C0B@0@= #0b@" B 0BT@$9 @0bT@$#"H0C0B@#H0b"H = &$H =%&$,4 =.@-``-="D 0B@V2@  -(- =+x$=!",$4C#$",$40B@$#"4"@=!<dB(@b!b$Bb0B@ =.<;d#<; !$c` @ -<B;b<B(̎$B<#;<"( =."@<(-S@ =  -0@z$bn`l2<f(@ @ -(- =+x$B=!p",$4C#$",$40B@$#"4@D"E P P C$TbP  -@-P"@=!o@V!C$cC0B@ =.<c;<; #"(!$c` @ -<B;b$B<#; =."@<eS@H!E =  -0@@R$b`22P@ $"L6-="k<H$ L(2=!L 2"0B""( @<H#r+T@`-V#r*T@`- =.4@(- 0- = ! =.@-=!4 R# #BY20BT@62@=""-",#4D#$c",#40B@$b#"4-0@=" < e)(@I!C$cC0B@ =.<c;<; #"(!$c` @ -<B;b<B(̎$B<#;<"( =."@<(-S@ =  -0@V=""@=""Ұ! -(-@0- =+x8- R!r# ",R#",#(` 2@r#@"("4B@="r"<@!<2@@2@`77 @2" B 0B@-`-"$@)"0B @% =%&$,@-`$ "HI$0B@#H$h$"H = &$H4 =.="-0@@  @" B 0B@2 X@2`$2@=">@D" 0B@6 =)&$,D 0B@ "@ -$0-$,@ 8- "T%""H0C0B@#H0b"H = &$H4 =.`-߿߾߷߶ߵxߴp߳h߲`߱X߰P''0-($2@82 @2 ="2@ -="-$0-$B@ 8-߿@߲8߱0߰('H'@-HXPH 4b@H0B@&, =% -="4bAH =. - =%@-"0C0B@#0b" = &$j"n"j#n#j$n$j%n% '(/078? - =$ =. -B 0B@BB@@ 4 =&r' -߿X߲P߱H߰@'`'H-P-@-0-(-48B\# P`$*b@$ (-'\@0-$b@ 8-=#$@,)A@$() @$$$"=#$*$$ =#$*)@ )`&$ $=#$*)P@z$*=#B$Tbs$ B"Rn$,BT@j$ B@'"H%=#Υ""C$=#Υ"R\$,BT@X$$)@$=#`M$%$,%$L =&JEP@E$7=# B=#έ"\ B=#έ"d/b-d-C/D-?E+@(=&n- @ =L(-+` $߿(߰ '0' ( =(9- ߿(߰ '0' @@0B@ =&=&@=&@0- ='߿ '(' 0-)8-@@C!$0B@$!P 0b@0b4B =' -߿ '(' 0-18-$$$D=&CE$HC!$0B@$! 0b@0b4B =' -߿ '('0-8-@-HP( q -0B@< = dR莂"!-`"!='`-CDB Ed # =QE(#Q*@I-b,Bm@$<S` = $@- $<dc("b$Bb&" " ='I $ =)$@- ='v-b% "f =\` -R-5  -BDC!$BD0B@$!BPR QP@@$߿PߵHߴ@߳8߲0߱(߰ 'X'(-@-8-H0` < = dRbr@`(-`B!-(-B!#$" %d # =QE(#R*@!-``(-"$C!$"$0B@$!"0R 3P@@$߿Hߴ@߳8߲0߱(߰ 'P'0- -(-8-M@0B` b%`( -@ + -Cb -R &P"0B@# "b(!!&#C+@#b =\ "C!"B -C!B =*=(%@-R P=(0PBDC!$BD0B@-$!B0" 0B"`  "S%=(2"< =e6dS߿@߳8߲0߱(߰ 'H' -(0B@ < = dS =(I =(Y -@@@< = dS(߿(߰ '0'(-0-PH@8 0-@O<f(<fS@ ``-< = dS8s=(D*@#"#D#$c"#0B@D#$b#"@T!C$cC0BP@ - =.<c;<; #"(!$c` @ -<B;b$B<#; =. -U!E = @RT3D<fR(<fS@"#D#$c"#0B@$b#"@R!C$cC0BP@ - =.<c;<; #"(!$c` @ -<B;bB$B<#;B =. -T!E = R3R 30=)  R! "R#=("߿PߵHߴ@߳8߲0߱(߰ 'X'0-H@8( Q E<fs(܎"<fS@BB#DC#$BD"0B@"$#B"@S!C$cC"0BP@ - =.$<c;<; #"(!$c` @ -#<B;bb#$B<#;b =. -"T!E = -߿Hߴ@߳8߲0߱(߰ 'P'( =. $@- =)$@ =. -=)}< = dS߿(߰ '0'(-0-<<40 =+@ -<BӰ@$<"Ӱ<dS =$ =*<B;=)+<B;@<$;-<d(<B;$c<$;$Bp*@$<d(Č$p!߿0߰('8' -(0 =*-$<(-S@ = 0-@ - @<dB(b!b$Bb$ -߿0߱(߰ '8' -(0 =*-$<(-S@ = 0-@ -@<dB(b!b$Bb$ $-߿0߱(߰ '8'80( =. <1<@ @-0"+@ ,@@ "&0+@1 =.@ -<dc(،b$Bb߿8߲0߱(߰ '@'(- -$0<(-S@ =  0-@ -@<dB(b!b$Bb$ =*O - =)(-@ --߿0߱(߰ '8'(- -$0<(-S@ =  0-@ -@<dB(b!b$Bb$ $=*w - =)(-@ --߿0߱(߰ '8'0-(-$8 <(-S@ = @0-@-@<dB(b!b$Bb& =*@ - =) (-@-- =$l-߿8߲0߱(߰ '@' -(<dB(@b!b$Bb0B@ =.<;d#<; !$c` @ -<B;b<B(̎$B<#;<"( =. -<(-S@ = -߿(߰ '0'(-@80 5 <fR(<fsS@"@R!C$cC"0BP@ - =.$<c;<; #"(!$c` @ -#<B;bB#$B<#;B =. -"S!E = -߿@߳8߲0߱(߰ 'H' -0-(-8<(-S@ = $@0-<dB(@b!b$Bb$ =+O =) -@0- =* -=+r-0BP@jn$ 0B0B.Bd@-$dR#$ D$b! -߿8߲0߱(߰ '@'0-h-@-`-8-X-pPH@(a< = dS@"0BT@$@'  < = dS#C*@' C#1@`l <;6 $uf< = dS=,"<eS@H!E = 0-@-"#<e(@h!b$Bb& =+Ц% =) -@-Jj"n"#& 0cu^#=+-%` - =L(#@0-"0B@" R! #<B;<;b# !$Bj"n"##$#$4B=, $  =\ !u-b#1`- T``-<B;$B<";=,$`- =*<c;-$c<#;߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x' -(-0-8- @A< = dS < = dS#*@## @-< = dS@(- =L #`(-B#b! @0- =\ !@--߿@߳8߲0߱(߰ 'H' -80(@-@ &0BT@ &b(!!R+@=,$ =\# -C! =*@- ߿8߲0߱(߰ '@0-H@-X0-*@#=,(# e!(- 0-0B@0#C#=,@(#`8!e*T@ 8#e#0-0B@E#=,8-0-0BT@g*P@8#T'(-H@80 "0B@-" &#S!C+@.be#` "S*@ -=-r -B`-=-:b#.be@b$"<(-S@ = $@-@"B#<dB(@b!b$Bb&B@@B =-'@% =)$@-@B@"0B@ j"n"BB"&CC 0BB"0B"B CC!$BB#<; =V` -@ - =L(-% =L@ -@-0-B E$ =\E(!Bp#P!B"#P#@"" P!=-`" =* -@-Z`Q =-?=-r@- =*@ - =* -<c;-$c<#;߿Hߴ@߳8߲0߱(߰ 'P'<d$(@-<dcd<<@$b0 <"<@<1<@ e"@@ 0"+@  @@ "&0+@1 <B;(B@$<";<B;<c;C!$db#<";<#; =.U =.--߿0߱(߰ '8<c<@`-bDc`-=-dc+@ -P@$0E-$0+@- 8-<c<@`#-bDc`=.-dc+@-$ `@-eF-T $0TF$0T`$0P8-$0+@-'(<1<@0-8-@  0"+@ @@ -`(-@ 0-"&0+@1 -߿@߳8߲0߱(߰ 'H'(<1<@0  0"+@ (@@ "&0+@1 <;<d(-0! =O0C-߿0߱(߰ '8'0<1<@8 (0"+@ $@@ "&0+@1 <c;<dT(-0x0-80-80-80-0x0-0?0C =O0#-߿8߱0߰('@<B;' 4B<"; =.߿ '('(<1Ӵ -*@0*@$<"Ӵ E$8?C!@#<"-"S` --'xP-X-H-x-h-@`-`$ApB0BAC-=3$2<h"<<l"<B`Bg'A$F@ -(-'0"'(0'4 =Aɯ$@-B0B@ (0B@ -(-<;4 =+x$@-4C(#0@$0B@$ & C+@$C$B8 $B$c  $b &=3qb$=3w8&$'( =\$"=3w8<dS؎EF =e6$/=3@p`@ -(- 0- =48-0b@ -0b@  $BP#,B@ $=3 $BP#,B@ - $B$c =3$ =+)$@-=3$70B@'8$B $ =\&% '( (- =\$&D&% =\$ =.CD d*` @- -B$$7$B =.B$=3BT@PPBCP$B0c`BB0@ @ - =. -Bl$BV!Bl(0B@ -Bt$B=3Bt- =* --߿߷x߶pߵhߴ`߳X߲P߱H߰@''(-0- -8<h"<<l"<"`"g<dS@(-$"h$BC! ="h@=44BB0B@4B0B@"p$B"pE $$ -=42<B;4B<"; =.<f1&`=46 =Br(-=4P- =* -=4P- =.#$ d*`@-" -$B =*"=4M"T@P0"0$B" =.@ --߿8߲0߱(߰ '@<dcӸ(-$:<"-"S$b$c0B<"-"S$b$cf(@$c<dBӸ`'<d3P<dBT $<"3V$<"3X<dB<"3<dBL<"3|$<"3< 3< 3 =/f߿ '('0- -8-@(0B@-< = dT "40B@ =* -"40B@$3$A=4`-BL$BBLBlC!Blf$ E< =e6dT( =* -=4$/ =.<f1&`<c&h<&ld*` @-<B&p$B<"&p =* - =.` -=4$7<B&dT@P0"<c;0$B"$b%<#; =.BD$BBDBh` -C! =.Bh-߿@߳8߲0߱(߰ 'H$P-< 4Bi 8-4B C$b<dB=5$-@ !Bb$`=5=5-@ !B$@!B$@=5*=5*-'`-0$$(-phXPH@8("3 @" # !Bb$`=5]11"A" (!!S0!+@ b#$+@$" 0B@[ -"T@@-=5 - @-#`" V0!+@ v8!$d&C$@$$+@(!1 -12@4$ =L(-@-< e)i!B(!S8!+@ 0-$$C$+@$<d =5 (-@-CC  - 0# =(!@=5-R@$)-߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x0$b (à"$$$($ # '8-@-H-PX0( q =5-@0- p!P(!q !D+@ $C&RC$D+@$=6A-S#Dd&`(C`$-`-  B!BC$@-=6$E+@` - =50-# $ C!c@0-d$T`&& B!BC$T@=6@-߿X߶PߵHߴ@߳8߲0߱(߰ '`'8-HP@0(S-<B@-@ -% =`0-@9 -$P$ = $@-  -=6- =$P&00@ -(- =\`0-- -<Bb!&b0B@ +@ @T&$B4B=>b!&b0B@+@-@&$B4B=>b!& -$ =6K$@-R $7% = -T@$76 b0B@ +@ \@&$B4B=><b!\%b0B @+T@db$C,b@<"-"U@$=?$0-LTc'0, =;$@-0&e d =@6$L0b6vD$B=?b6$LbT0-, =;$=?@-L =::(-@- $cb'(b LL =@=?$@ TQb$; =䏤T@=?$;c$b (b@$b=?$bA=? L@$B4B=>$RE$Hb4Cc0 $@&C$B4B=>b!&Rb=>4Bb$b T@&C$B4B=>b!&Rb=>4Bb$C$bD $@&C$B4B=>b!&Rb=>4BbC$bb0B0@0b!&R@BdB@&C$B4B=? b!&Rb=?4B0\b$C$bbR*@@ -$ = $@-` -=?$7f =\(-` - = $-r4bjLnSjTn[j\ncjdnkb b'c(c/d0d7e8e?lb@L@&pD$B4B=?C$R$L(- =\@0- !@$B4B=?P$R$ -(- =\@0-!T @$B4B=?_$R$T(- =\@0-! @$B4B=?m$R$ -(- =\@0-!\@$B4B=?|$R$(-\ =\@0-d@!$B4B=?$R$d(- =\@0-=? 0RB*@=?$E\ =0W\@-   dP - =0 (-=?@-d =0d@-4 =;E0-@- @P P@@B@$(-@ 0-@< -0 =\@0-&e d =@6&L@@B@$(-@ 0-VDbd LD$b%Lb'b$=?L$-`=?wb4B@b =: -D0B@@-<B&(B@ `` - = $< =*=@*-` (-D-C-D-C-D-?#BC!b##@C!<dc50C!(--"C($(@&1(P@- H" 0B@D&P -&E =\$&$(- =\$&P -&E =\$'D(- =\$$B$$$=CB &Db0B @ '2 -(-<;4 =+x$L&D'2 =\$` -(-'00-$>$10b,@ 8-L ` -L0- $B,@ 8-=C =* -߿߾߷߶ߵߴx߳p߲h߱`߰X'' -0 =.( @- =* - =.߿0߱(߰ '8<B'@-8$0-H@ (<d@$<;<" =O(-d(-D-C-D-C-D-d?#BC!b# #@D!<dc50C! @0B@$ C*@`--(@&  -=DC- =C --d$C D߿H߳@߲8߱0߰('P'8-0-$PH@(#""$b -"@=D$/ =.@-$(-D-C-D-C-D-$?#BC!b##@C!<dc50C!D($(@&(P@-<$4BiB =.` -=D$ =0W -@<$ =.` -=D$34Bi B3R*@<$<$4BiB =D4BiB,<$4Bi&B*&=D&$& =C@ -@- " 0B@&$ =C@ -@ =C - =.` -=D$1 =C@ -&$& =\$" 0B4B=Dע =C -=D&&% =\$ " =.` --߿PߴH߳@߲8߱0߰('X'0-<8<=D4,=D8'<$C$4<; $$ E$C4$%  -' =d$-߿8߰0'@'<=E<<$C<=E<$E-=E*b,=E*$$<c;`($b c4`-'' -=EI0-<< $=EI<<$C<< $=EI<$F$$ $=EI$b#=Ea<c;P` $b f,c4`$$d+@b@$$cd+@''0-<<($<4B=E $<$C<<($=E0$E$=E-b,'=E$($0<c;`-b c4`-'<BV@<;-$ $PC$4-=E<; -,($PC$4-<$PC -< $$$=E-$'8-X-@-0-P-H-@ `<;<  PR< 4< 4Bi"(Q*@< < 4Bi"7Q*@< 4Bi "2$-=G4Bi"u< 4Bi"*$-=G4Bi#Q*@ < 4Bi!"*@l<@4Bi"$-=G4Bi%"d=G$-c$b <  4Bi R-p $$E@ - =,l@ $($ =,l@ -($t b b` - =Ԯ$ =*p $$BD0cC!0BB 0cC# B -@@(-BR@b!=P-<dc6b@ -$B =*b-߿PߴH߳@߲8߱0߰('X'0-@8( Q 2 $0 =P - =*3 $-2 =@ -$ =*D $߿@߳8߲0߱(߰ 'H D  b b'@80( =. <dc7p@-<f16`-$BB@"$B" =P =.@ -߿@߳8߲0߱(߰ 'H'<d70( D -<f16"$B =P"P߿0߱(߰ '8'p-xh`XPH@80 $ ,0B$V&<f̒P$$S`*@$D=Q&$Db*E@$B=QӰ#$$VӰ#Q*"@&<d =0T@&1$Ӱ#=Q$&bQ+@Q ! =R5@ -=QӰ#(- =\$$ < =0/d@ $D< =E =Hd@ -=Qp =R @$D<Q(!<B$ =\뮂B$=Q,Q*"@x&1&bQ+T@cӰ#&(- =\$ =0&@$D< =R @d$D<Q(! =\$B$B=QBT0#E,@]@-D$D+@D!B$D $0B$B0B %@MD=QӰ#C$0cg $P(bP@$`! -=Qb$=Q -$+@8 - =M$D<(- =\$=Q+@+ -(- =\$ =0&P@Ӱ#B$BB =N0' %$E(! =\$"$B"Ӱ#AS!, - =R$=Q$=Q-$=Q$$=Q$&B0# - =K(-$߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0''0-<7`(<f7d8<B7h"(-6@-(B@$b =:=R!6< 7`<d7`$$ =:%<B7`P@-B@߿8߱0߰('@'0( .,@ -<d =\0-&<"4<C$<C$=SG$@,$E- $C&,U` -(-<d7` =S$@ -<dc6b$B=Sgb<dc6b$Bb' =* -=S<B6$B<"6,B@<"-"X@$=S~$$<dc6̌b$$B=S~b$- -(-0-8- =K߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x'8---$-xDL =U1'8@-8LD2 1@<4c<B<$<BH@<B@@5-<:<C-BHD!<#-"H$c<C-B@@<B@@"-<f@ =i@ -@&@&1Q! <D-B@@$<D-BD@ $$<$-#D<$- P=e0&"$߿8߲0߱(߰ '@'(-<dh =o'0߿ '('( ' =sP$߿('0' &<dh =eD&߿ '(',@ ,@ =eh=ee =f{߿ '('(-`-@-X-hPH80 C'T#!+H@&)! - @(-@-@ - `(- @- - `(-A  -=e`-@- - `(-@ -`-  -B$&E&RT#-=e - @(-@S+4!2+@ -=eS+ `(-@=et#24!`-=et#S+@@ -2@- - -t# -%b$"&1e$c-=e$`-=e@-- -=fg(-Q#T $<A #$V*@@T!*@*@ -(-0- =eh8-=ew-@*$@ -T! - @(-A* -B$&E&R=f*(-0- =f{8-*@*@[$ -4! -  (-AS -"$&%&1=fo=fg(-=ew-*@* -(-0- =eh8-=fm@-@*$ -4! -  (-A* -"$&%&1=fP*(-0- =f{8-*@*@$@ -T! - @(-A -B$&E&R=fo(-0- =f{8-=fo@-=ew-߿h߾`߷X߶PߵHߴ@߳8߲0߱(߰ 'p'0-8-(r!H-XP@@h!4+@+ $2#+T@ ! - (-C!#+@ -!0&E4+$2#&p+@ -b` -#p+@$&1=f4+2!4+@2#߿X߶PߵHߴ@߳8߲0߱(߰ '`'(-(0@ =n^=f$8D! <d-cD$b-<dB@! q!+T@# - 0- =d(! -b!߿0߱(߰ '8'(-<dX =g'0߿ '(' =g'8߿ '(' =g''8߿ '('-(-0-' $8 =]@0-@' (- =g' 0-=g"$߿8߱0߰('@'pH-@-`-X-p-xhP @-$l$L"@- =_z@$%=g@&b=go&<d[0 =i3.@"$*g`-=gn$P~&w$B0B,B @- =_n@' =g_&@(- =j-0#' ' =[$ &&@.$s$c$ =_z@=gw&1 @ <d[@ =iY -=g  @$ `&$b$$td =j- (- =g"!< =i3d[H@< =_z$@$d=g&1b$ub$x=g$ b$o=g$b$b=g$Pb$ @'  =_z@<d[@ =iY -=gʯ =i3 -Q# '  =j- (- ` "!&$b$$td' =[0-R`&- =g&$ =_z@=g&1"b-&&1@O-߿߾߷x߶pߵhߴ`߳X߲P߱H߰@'' =o'8߿ '('8-(-0- --@<C-B\@$&*@$c$R--R -<d[P =i -@=h5-<d[X =i -@=h5$<d[` =i -T@$` -@(- =d0-@ -$ <dBX<#-$X$<#-$\=hIb!-߿@߳8߲0߱(߰ 'H' -( =j  -@-$b,B@$b=hk$,B>@$^b-=hk0-߿(߰ '0'0-(- 8 =j -@(-$*P@$ %#=h$"%#=h 2@ - =i$ &1 @ -=h%#(<d[h =i@ -&!=h%# @ - =i$0&1 @ -=hC!C!"#<d[h =i@ -& @ - =i$ &1 @ -߿8߲0߱(߰ '@'<d[p< e)[x@(8-.-bE!$cb@$!B@'!G`0-FPH$TC$$T$=h-$@-'' =i-F$$@,B''-@ 0-$T@$=i$$T@-'' -(-0 =j !-q=i.`-߿0߱(߰ '8'=iF-@ .E-$@-'- $$@$b@$c-@@- 0--bG!$cb@$!B@$@%- -@-bb$cb@-'(-0 =j =_@ -@- - =iH (--߿0߱(߰ '8'0- 8=i$=i- =_z&@&T@&$߿8߰0'@'=i-$C$@,B'-@ -$cbT@$c=id+bb$cd+@-'8-@-H 0@ =i- =oh&D =oh@-&1&R"$T@&B,B߿H߲@߱8߰0'P'0-(- -8 =j @-@ -&R%&1 =i&@ -߿8߲0߱(߰ '@ -@-$@$c`--b`$$$=j+-b#' 8-=j9P $$$@-''h`XPHW@U' '!$=jP C&R@$$B$ޢ@=j\"$#@&1' $"  @3' $*$?#`+t&1"@  -C $*S' &P@ (-C'  (- =j-0#-@ - =j' @-"- =j ' =j!Ps&1Bb-&1&RB@B@"@=j$=j-C`-$$*",B߿hߴ`߳X߲P߱H߰@'p'0-8-=j@ - =i3.P@&=j-T@.-߿@߱8߰0'H'0-&8%- =j  -=j!@-8-TG& -@ 0-b$@$@-&@-߿8߰0'@' -(-0=k-=k- =j  -@-`.p !E$ca$-߿0߱(߰ '8'0-8-(-PH@ =j $BB!P+@-$($)=k7&1P &1 =i3` -P@&V &=k;-&P+@-߿PߵHߴ@߳8߲0߱(߰ 'X' -(<$L<L =tT(-<cL(-b! =iY -@!=kb-<#Lb@$b<"L`-߿(߰ '0'0- 8=kq =oh&&@&߿8߰0'@' =k߿ '(' PH@80(<D-B@-=k$<D-B@-@ - <>`0-=k<D-Bb!<dB8``b!$ - =kB*0B@@ -T =k$ @ -& =k&13*@ -߿PߴH߳@߲8߱0߰('X' -0(@- =k@@ @ $@$ =k=k =k><f0@ $@$>@ >߿0߱(߰ '8<B8h'0<fR8`@8(@L $&Q%&"@ $P@@&1H%&"@ $# 0c `@(-0"&0B@"( - = $=l# 0b@0b@BT@ܮ@"1=lS"0=l@$b# =s* @" 0B@" @@ -3 =k$=l"@&RH<B;$@ =/ ߿@߳8߲0߱(߰ 'H' -@80(<C-B@-<#-#`C!<dc8`C!$, @<"-"[@j"(n"/j#0n#7j$8n$?j%@n%Gbbccddee=m,- =t$@g",G$% "&@ 0@$jbnbjcncjdndjene"("/#0#7$8$?%@%G=m,- =k"B=m+b=m+3"=m+b$"*$".$ "5$"2$"9"($#0#6$#84B`=m+"(`j"(n"/j#0n#7j$8n$?j%@n%Gbbccddee".$#40B=m+".`j"(n"/j#0n#7j$8n$?j%@n%Gbbccddee".$#40B=m+".`"$@.$% =iH` -=m,-<B@"-<f =i` -@&@&R<C-BP@$" <C-B=m+"$<(-$ =iH` -=m,&=m,$-߿@߳8߲0߱(߰ 'H'' <d[`XPH@80 =iH(<B0@Y-$--*b@T-<dB8`!<dB0!@@@$0-@ 8- =sݮD@B< E<&PF&F F"`DD<d! <d! <d!X <d! <d! <d! <d!l  @K   $$# #K##'(@' =sӬ =f$@$ ߿('0' =s߿ '('(-( $$@< =e6d]=s- =_$P@-P@@߿(߰ '0' -0(b-< =kyd]bC!D$!Q$B߿0߱(߰ '8' -(@< =kyd]@$!$Bd$߿(߰ '0$(@$$=tF$=tF$=tF=tFb#*@-E!C$!B@@- 0--bG!$cb@$!B@$@%-